The URL can be used to link to this page

Home My WebLink About20231017 CC RM - Packet AGENDA City Council Regular Meeting Tuesday, October 17, 2023 7:00 PM Council Chambers 1. CALL TO ORDER/PLEDGE OF ALLEGIANCE 2. APPROVAL OF AGENDA 3. PRESENTATIONS, PROCLAMATIONS AND ACKNOWLEDGMENTS 4. RESPONSE TO PUBLIC COMMENT 5. PUBLIC COMMENT Individuals will be allowed to address the Council on subjects that are not a part of the meeting agenda. Typically, replies to the concerns expressed will be made via letter or phone call within a week or at the following council meeting. 6. CONSENT AGENDA a. Bill Listings b. Minutes of the October 3, 2023 Regular Meeting Minutes c. Minutes of the October 3, 2023 Work Session Proceedings d. Donation Acceptance from American Legion Post No. 65 - Police Department e. Donation Acceptance from American Legion Post No. 65 - Fire Department f. Hiring New Firefighters g. Engineering Services Contract Amendment for 2023 Neighborhood Improvement h. Land Exchange Agreements i. Appointment of Additional Election Judges for November 7, 2023 Election j. Bella Vista Greenway Trail Project - Change Order k. Declaration of Surplus Property – Parks and Recrea l. Life Time Facility - Change Order #1 m. Joint Powers Agreement with Dakota County - Absentee Voting Administration Services in 2024 and 2025 n. Approval of the Amber Fields 13th Addition Preliminary Plat and a Minor Amendment to the Planned Unit Development Agreement 7. PUBLIC HEARINGS Qbhf!2!pg!311 a. Schafer Richardson Conduit Financing Authorization Request Amendment b. Request by SKB Environmental for an extension of its current Interim Use Permit 8. UNFINISHED BUSINESS 9. NEW BUSINESS a. PD PW Campus Update and Change Order Package #1 10. ANNOUNCEMENTS a. City Staff Updates b. Upcoming Community Calendar 11. ADJOURNMENT Qbhf!3!pg!311 10-06-2023 10:51 AM A/P PAYMENT REGISTER PAGE: 1 PACKET: 06807 10/06/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-002533 MARCO TECHNOLOGIES LLC I INV11687836 COPIER COSTS & LEASE APBNK 10/06/2023 R 9/29/2023 1,198.45 1,198.45CR G/L ACCOUNT CK: 153531 1,198.45 101 41810-01-202.00 DUPLICATING & COPYING COSTS 712.79 COPIER COSTS & LEASE 101 41810-01-580.00 OTHER EQUIPMENT 485.66 COPIER COSTS & LEASE REG. CHECK 1 1,198.45 1,198.45CR 0.00 1,198.45 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-005066 MARCO TECHNOLOGIES LLC I 511639007 COPIER LEASE MX-5071 APBNK 10/06/2023 R 9/22/2023 244.23 244.23CR G/L ACCOUNT CK: 153532 244.23 101 41810-01-580.00 OTHER EQUIPMENT 244.23 COPIER LEASE MX-5071 REG. CHECK 1 244.23 244.23CR 0.00 244.23 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-240010 XCEL ENERGY I 8807010-0 9/23 WELL #15 APBNK 10/06/2023 R 9/25/2023 6,466.70 6,466.70CR G/L ACCOUNT CK: 153533 6,466.70 601 49425-01-381.00 ELECTRIC UTILITIES 6,466.70 WELL #15 REG. CHECK 1 6,466.70 6,466.70CR 0.00 6,466.70 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!4!pg!311 10-06-2023 10:51 AMA/P PAYMENT REGISTERPAGE:2 PACKET:06807 10/06/2023 AP CHECK RUN VENDOR SET: 01 =================================================== R E P O R T T O T A L S =================================================== F U N D D I S T R I B U T I O N FUND NO# FUND NAME AMOUNT ---------------------------------------------------------- 101 GENERAL FUND1,442.68CR 601 WATER UTILITY FUND6,466.70CR ** TOTALS ** 7,909.38CR ==================================================================================================================================== ---- TYPE OF CHECK TOTALS ---- GROSSPAYMENTOUTSTANDING NUMBERBALANCEDISCOUNT HAND CHECKS0.000.000.00 0.000.00 DRAFTS0.000.000.00 0.000.00 REG-CHECKS37,909.387,909.38CR0.00 7,909.380.00 EFT0.000.000.00 0.000.00 NON-CHECKS0.000.000.00 0.000.00 ALL CHECKS 3 7,909.38 7,909.38CR 0.00 7,909.380.00 ------------------------------------------------------------------------------------------------------------------------------------ ERRORS:0WARNINGS:0 Qbhf!5!pg!311 10/04/2023 3:00 PM A / P CHECK REGISTER PAGE: 1 PACKET: 06805 10/05/23 PYRL Regular Payments VENDOR SET: 01 *** DRAFT/OTHER LISTING *** BANK : PYBNK MERCHANTS BANK - PY ITEM PAID ITEM ITEM VENDOR NAME / I.D. DESC TYPE DATE DISCOUNT AMOUNT NO# AMOUNT 011310 AFLAC C-202310049885 AFLAC INSURANCE PREMIUMS D 10/05/2023 98.00 001643 I-161202310049884 AFLAC INSURANCE PREMIUMS D 10/05/2023 406.24CR 001643 I-162202310049884 AFLAC INSURANCE PREMIUMS D 10/05/2023 311.94CR 001643 620.18 005806 BPAS-BENEFIT PLANS ADMIN SRVS I-250202310049884 VEBA - EMPLOYEE CONTRIBUTIONS D 10/05/2023 90.00CR 001644 I-252202310049884 EMPLOYER VEBA CONTRIBUTIONS D 10/05/2023 158.75CR 001644 248.75 000003 INTERNAL REVENUE SERVICE I-T1 202310049884 FEDERAL WITHHOLDING D 10/05/2023 33,008.61CR 001645 I-T3 202310049884 FICA W/H & CONTRIBUTIONS D 10/05/2023 30,232.06CR 001645 I-T4 202310049884 MEDICARE W/H & CONTRIBUTIONS D 10/05/2023 10,554.60CR 001645 73,795.27 000004 MN DEPT OF REVENUE I-T2 202310049884 MN STATE WITHHOLDING D 10/05/2023 15,817.03CR 001646 15,817.03 002238 MN STATE RETIREMENT SYSTEM I-260202310049884 MSRS-EMPLOYEE CONTRIBUTION D 10/05/2023 555.00CR 001647 I-262202310049884 MSRS-EMPLOYEE CONTRIBUTION D 10/05/2023 941.59CR 001647 I-263202310049884 MSRS-EMPLOYEE CONTRIBUTION D 10/05/2023 700.00CR 001647 I-264202310049884 MSRS-EMPLOYEE CONTRIBUTION D 10/05/2023 510.00CR 001647 I-350202310049884 DEFERRED COMP WITHHOLDING D 10/05/2023 3,584.00CR 001647 I-351202310049884 DEFERRED COMP WITHHOLDING D 10/05/2023 319.29CR 001647 I-352202310049884 ROTH 457 CONTRIBUTIONS D 10/05/2023 2,635.00CR 001647 I-353202310049884 ROTH 457 CONTRIBUTIONS D 10/05/2023 643.48CR 001647 I-354202310049884 DEF COMP W/H INS. WAIVER D 10/05/2023 4,420.00CR 001647 14,308.36 140290 NATIONWIDE RETIREMENT SOL I-310202310049884 DEFERRED COMP WITHHOLDING D 10/05/2023 4,056.39CR 001648 I-311202310049884 DEFERRED COMP WITHHOLDING D 10/05/2023 818.30CR 001648 I-312202310049884 DEF COMP W/H INS. WAIVER D 10/05/2023 1,814.68CR 001648 I-340202310049884 ROTH 457 CONTRIBUTIONS D 10/05/2023 1,438.92CR 001648 I-341202310049884 ROTH 457 CONTRIBUTIONS D 10/05/2023 95.48CR 001648 8,223.77 162110 PUBLIC EMPLOYEE I-300202310049884 PERA W/H - COORDINATED D 10/05/2023 33,509.54CR 001649 I-301202310049884 PERA W/H - POLICE DEPT D 10/05/2023 37,266.76CR 001649 I-302202310049884 PERA W/H - ELECTED D 10/05/2023 273.00CR 001649 71,049.30 005807 WEX HEALTH INC I-230202310049884 HSA - EMPLOYEE CONTRIBUTION D 10/05/2023 3,287.90CR 001650 I-231202310049884 EMPLOYER HSA CONTRIBUTIONS D 10/05/2023 317.50CR 001650 3,605.40 Qbhf!6!pg!311 10/04/2023 3:00 PM A / P CHECK REGISTER PAGE: 2 PACKET: 06805 10/05/23 PYRL Regular Payments VENDOR SET: 01 *** DRAFT/OTHER LISTING *** BANK : PYBNK MERCHANTS BANK - PY ITEM PAID ITEM ITEM VENDOR NAME / I.D. DESC TYPE DATE DISCOUNT AMOUNT NO# AMOUNT * * T O T A L S * * NO# DISCOUNTS CHECK AMT TOTAL APPLIED REGULAR CHECKS: 0 0.00 0.00 0.00 HANDWRITTEN CHECKS: 0 0.00 0.00 0.00 PRE-WRITE CHECKS: 0 0.00 0.00 0.00 DRAFTS: 8 0.00 187,668.06 187,668.06 VOID CHECKS: 0 0.00 0.00 0.00 NON CHECKS: 0 0.00 0.00 0.00 CORRECTIONS: 0 0.00 0.00 0.00 REGISTER TOTALS: 8 0.00 187,668.06 187,668.06 TOTAL ERRORS: 0 TOTAL WARNINGS: 0 Qbhf!7!pg!311 10/04/2023 3:00 PMA / P CHECK REGISTERPAGE: 3 PACKET:06805 10/05/23 PYRL Regular Payments VENDOR SET: 01*** DRAFT/OTHER LISTING *** BANK: PYBNK MERCHANTS BANK - PY ITEM PAIDITEMITEM VENDOR NAME / I.D.DESCTYPE DATEDISCOUNTAMOUNTNO#AMOUNT ** POSTING PERIOD RECAP ** FUND PERIOD AMOUNT ------------------------------------------- 10110/2023154,779.60CR 20110/20231,542.80CR 60110/20239,379.55CR 60210/20239,379.58CR 60310/20238,517.09CR 65010/20234,069.44CR =========================================== ALL 187,668.06CR Qbhf!8!pg!311 10-04-2023 2:50 PM A/P PAYMENT REGISTER PAGE: 1 PACKET: 06804 10/05/23 PYRL EFT Payments VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK EFT STAT DUE DT GROSS PAYMENT OUTSTANDING DATE/# DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-005836 ICMA RETIREMENT CORP I 330202310049884 ICMA CONTRIBUTIONS-PLAN#303 PYBNK 10/05/2023 E 10/05/2023 1,640.76 1,640.76CR G/L ACCOUNT CK: 000103 1,640.76 101 21724 DEFERRED COMP 1,041.31 ICMA CONTRIBUTIONS-PLAN#303970 601 21724 DEFERRED COMP 158.15 ICMA CONTRIBUTIONS-PLAN#303970 602 21724 DEFERRED COMP 158.15 ICMA CONTRIBUTIONS-PLAN#303970 603 21724 DEFERRED COMP 283.15 ICMA CONTRIBUTIONS-PLAN#303970 I 331202310049884 ICMA CONTRIBUTIONS-PLAN#303 PYBNK 10/05/2023 E 10/05/2023 95.48 95.48CR G/L ACCOUNT CK: 000103 95.48 101 21724 DEFERRED COMP 74.17 ICMA CONTRIBUTIONS-PLAN#303970 650 21724 DEFERRED COMP 21.31 ICMA CONTRIBUTIONS-PLAN#303970 I 333202310049884 ICMA INS. WAIVER-PLAN#30397 PYBNK 10/05/2023 E 10/05/2023 1,296.20 1,296.20CR G/L ACCOUNT CK: 000103 1,296.20 101 21724 DEFERRED COMP 1,011.03 ICMA INS. WAIVER-PLAN#303970 601 21724 DEFERRED COMP 103.70 ICMA INS. WAIVER-PLAN#303970 602 21724 DEFERRED COMP 103.70 ICMA INS. WAIVER-PLAN#303970 603 21724 DEFERRED COMP 77.77 ICMA INS. WAIVER-PLAN#303970 I 334202310049884 ROTH 457 CONTRIBUTIONS PYBNK 10/05/2023 E 10/05/2023 150.00 150.00CR G/L ACCOUNT CK: 000103 150.00 101 21720 ROTH 457 CONTRIBUTIONS 150.00 ROTH 457 CONTRIBUTIONS EFT 1 3,182.44 3,182.44CR 0.00 3,182.44 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!9!pg!311 10-04-2023 2:50 PMA/P PAYMENT REGISTERPAGE:2 PACKET:06804 10/05/23 PYRL EFT Payments VENDOR SET: 01 =================================================== R E P O R T T O T A L S =================================================== F U N D D I S T R I B U T I O N FUND NO# FUND NAME AMOUNT ---------------------------------------------------------- 101 GENERAL FUND2,276.51CR 601 WATER UTILITY FUND261.85CR 602 SEWER UTILITY FUND261.85CR 603 STORM WATER UTILITY FUND360.92CR 650 ARENA FUND21.31CR ** TOTALS ** 3,182.44CR ==================================================================================================================================== ---- TYPE OF CHECK TOTALS ---- GROSSPAYMENTOUTSTANDING NUMBERBALANCEDISCOUNT HAND CHECKS0.000.000.00 0.000.00 DRAFTS0.000.000.00 0.000.00 REG-CHECKS0.000.000.00 0.000.00 EFT13,182.443,182.44CR0.00 3,182.440.00 NON-CHECKS0.000.000.00 0.000.00 ALL CHECKS13,182.443,182.44CR0.00 3,182.440.00 TOTAL CHECKS TO PRINT: 0 ------------------------------------------------------------------------------------------------------------------------------------ ERRORS:0WARNINGS:0 Qbhf!:!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 1 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-004186 ADVANCE AUTO PARTS I 1596-ID-375739 SUPPLIES AND PARTS APBNK 10/12/2023 R 9/08/2023 385.73 385.73CR G/L ACCOUNT CK: 153534 385.73 101 43100-01-215.00 SHOP MATERIALS 273.49 SUPPLIES AND PARTS 101 43100-01-221.00 EQUIPMENT PARTS 112.24 SUPPLIES AND PARTS I 1596-ID-375740 PARTS APBNK 10/12/2023 R 9/08/2023 100.27 100.27CR G/L ACCOUNT CK: 153534 100.27 101 43100-01-221.00 EQUIPMENT PARTS 100.27 PARTS I 1596-ID-376169 BRAKE CYLINDER,PADS & ROTOR APBNK 10/12/2023 R 9/15/2023 638.40 638.40CR G/L ACCOUNT CK: 153534 638.40 101 43100-01-221.00 EQUIPMENT PARTS 638.40 BRAKE CYLINDER,PADS & ROTORS I 1596-ID-376170 PARTS,SUPPLIES & ADDITIVES APBNK 10/12/2023 R 9/15/2023 758.25 758.25CR G/L ACCOUNT CK: 153534 758.25 101 43100-01-215.00 SHOP MATERIALS 128.40 PARTS,SUPPLIES & ADDITIVES 101 43100-01-213.00 LUBRICANTS & ADDITIVES 131.01 PARTS,SUPPLIES & ADDITIVES 101 43100-01-221.00 EQUIPMENT PARTS 498.84 PARTS,SUPPLIES & ADDITIVES I 1596-ID-376542 PARTS,LUBE & ADDITIVES APBNK 10/12/2023 R 9/22/2023 100.56 100.56CR G/L ACCOUNT CK: 153534 100.56 101 43100-01-213.00 LUBRICANTS & ADDITIVES 38.72 PARTS,LUBE & ADDITIVES 101 43100-01-215.00 SHOP MATERIALS 51.36 PARTS,LUBE & ADDITIVES 101 43100-01-221.00 EQUIPMENT PARTS 10.48 PARTS,LUBE & ADDITIVES I 1596-ID-376543 PARTS APBNK 10/12/2023 R 9/22/2023 202.77 202.77CR G/L ACCOUNT CK: 153534 202.77 101 43100-01-221.00 EQUIPMENT PARTS 202.77 PARTS I 1596-ID-376889 PARTS APBNK 10/12/2023 R 9/29/2023 171.57 171.57CR G/L ACCOUNT CK: 153534 171.57 101 43100-01-221.00 EQUIPMENT PARTS 171.57 PARTS I 1596-ID-376890 PARTS APBNK 10/12/2023 R 9/29/2023 19.78 19.78CR G/L ACCOUNT CK: 153534 19.78 101 43100-01-221.00 EQUIPMENT PARTS 19.78 PARTS I 1596-ID-376891 ADDITIVES & SHOP SUPPLIES APBNK 10/12/2023 R 9/29/2023 96.35 96.35CR G/L ACCOUNT CK: 153534 96.35 101 43100-01-213.00 LUBRICANTS & ADDITIVES 19.31 ADDITIVES & SHOP SUPPLIES 101 43100-01-215.00 SHOP MATERIALS 77.04 ADDITIVES & SHOP SUPPLIES I 1596-ID-376892 OIL & PARTS APBNK 10/12/2023 R 9/29/2023 473.75 473.75CR G/L ACCOUNT CK: 153534 473.75 101 43100-01-213.00 LUBRICANTS & ADDITIVES 71.64 OIL & PARTS Qbhf!21!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 2 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 101 43100-01-221.00 EQUIPMENT PARTS 402.11 OIL & PARTS REG. CHECK 1 2,947.43 2,947.43CR 0.00 2,947.43 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-005942 ALEX AIR APPARATUS 2 LLC I 7326 QUARTERLY AIR TEST APBNK 10/12/2023 R 9/12/2023 305.00 305.00CR G/L ACCOUNT CK: 153536 305.00 101 42210-01-313.00 TEMPORARY SERVICE FEES 305.00 QUARTERLY AIR TEST I 7330 QUARTERLY AIR TEST APBNK 10/12/2023 R 9/12/2023 305.00 305.00CR G/L ACCOUNT CK: 153536 305.00 101 42210-01-313.00 TEMPORARY SERVICE FEES 305.00 QUARTERLY AIR TEST REG. CHECK 1 610.00 610.00CR 0.00 610.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-006051 ALL STATE CRANE CORPORATION I 9009 DUMP CLEANUP APBNK 10/12/2023 R 9/15/2023 3,000.00 3,000.00CR G/L ACCOUNT CK: 153537 3,000.00 101 43121-01-409.00 TREE TRIMMING 1,500.00 DUMP CLEANUP 101 45202-01-409.00 OTHER CONTRACTED REPAIR & MAIN 1,500.00 DUMP CLEANUP REG. CHECK 1 3,000.00 3,000.00CR 0.00 3,000.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-005879 ALLIANT ENGINEERING INC I 75255 AKRON AVE SOUTH EXTENSION APBNK 10/12/2023 R 9/21/2023 13,598.60 13,598.60CR G/L ACCOUNT CK: 153538 13,598.60 483 48000-01-303.00 ENGINEERING FEES 13,598.60 AKRON AVE SOUTH EXTENSION REG. CHECK 1 13,598.60 13,598.60CR 0.00 13,598.60 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-006052 AMERICAN TEST CENTER I 2231745 AERIAL & GROUND LADDER TEST APBNK 10/12/2023 R 9/13/2023 1,168.00 1,168.00CR G/L ACCOUNT CK: 153539 1,168.00 101 42210-01-310.00 TESTING SERVICES 1,168.00 AERIAL & GROUND LADDER TESTS REG. CHECK 1 1,168.00 1,168.00CR 0.00 1,168.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!22!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 3 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-003976 ASSURED SECURITY I 229743 ARENA REPAIRS APBNK 10/12/2023 R 9/25/2023 1,147.50 1,147.50CR G/L ACCOUNT CK: 153540 1,147.50 650 45130-01-404.00 CONTRACTED MACH & EQUIP R & M 1,147.50 ARENA REPAIRS REG. CHECK 1 1,147.50 1,147.50CR 0.00 1,147.50 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-004368 AXON ENTERPRISE INC I INUS191952 BWC CONTRACT APBNK 10/12/2023 R 10/02/2023 21,845.93 21,845.93CR G/L ACCOUNT CK: 153541 21,845.93 207 49007-01-575.00 OTHER EQUIPMENT PURCHASES 21,845.93 BWC CONTRACT REG. CHECK 1 21,845.93 21,845.93CR 0.00 21,845.93 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-006053 B&D ASSOCIATES LLC I 2023-0369 RSMT LIFETIME ATHLETIC PROJ APBNK 10/12/2023 R 9/30/2023 688,750.00 688,750.00CR G/L ACCOUNT CK: 153542 688,750.00 476 48000-01-521.00 BUILDING & STRUCTURE PURCHASES 688,750.00 RSMT LIFETIME ATHLETIC PROJ REG. CHECK 1 688,750.00 688,750.00CR 0.00 688,750.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-003889 BERRY COFFEE COMPANY I 974958 COFFEE SUPPLIES FOR SC APBNK 10/12/2023 R 10/05/2023 134.73 134.73CR G/L ACCOUNT CK: 153543 134.73 101 45100-30-219.00 OTHER OPERATING SUPPLIES 134.73 COFFEE SUPPLIES FOR SC REG. CHECK 1 134.73 134.73CR 0.00 134.73 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-004321 BHE COMMUNITY SOLAR LLC I 11904641 AUGUST SOLAR SUBSCRIPTIONS APBNK 10/12/2023 R 9/28/2023 3,199.08 3,199.08CR G/L ACCOUNT CK: 153544 3,199.08 601 49409-01-381.00 ELECTRIC UTILITIES 2,681.86 AUGUST SOLAR SUBSCRIPTIONS 601 49425-01-381.00 ELECTRIC UTILITIES 517.22 AUGUST SOLAR SUBSCRIPTIONS REG. CHECK 1 3,199.08 3,199.08CR 0.00 3,199.08 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!23!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 4 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-004012 BOLTON & MENK INC I 0321178 BONAIRE PATH QUIET ZONE APBNK 10/12/2023 R 9/27/2023 161.00 161.00CR G/L ACCOUNT CK: 153545 161.00 446 48000-01-303.00 ENGINEERING FEES 161.00 BONAIRE PATH QUIET ZONE I 0321179 CARAMORE CROSSING APBNK 10/12/2023 R 9/27/2023 357.00 357.00CR G/L ACCOUNT CK: 153545 357.00 454 48000-01-303.00 ENGINEERING FEES 357.00 CARAMORE CROSSING REG. CHECK 1 518.00 518.00CR 0.00 518.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-021815 BRAUN INTERTEC CORP I B360797 PW-PD CAMPUS PROJECT APBNK 10/12/2023 R 10/05/2023 1,550.00 1,550.00CR G/L ACCOUNT CK: 153546 1,550.00 421 48000-01-303.00 ENGINEERING FEES 1,550.00 PW-PD CAMPUS PROJECT REG. CHECK 1 1,550.00 1,550.00CR 0.00 1,550.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-004103 BUSINESS ESSENTIALS I WO-1263968-1 COPIER PAPER APBNK 10/12/2023 R 10/04/2023 88.50 88.50CR G/L ACCOUNT CK: 153547 88.50 101 41810-01-203.00 PRINTED FORMS & PAPER 88.50 COPIER PAPER REG. CHECK 1 88.50 88.50CR 0.00 88.50 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-000717 CEMSTONE PRODUCTS CO I 7262461 CONCRETE FOR CURB APBNK 10/12/2023 R 9/08/2023 569.25 569.25CR G/L ACCOUNT CK: 153548 569.25 101 43121-01-410.00 CONCRETE SIDEWALK/CURB REPAIRS 569.25 CONCRETE FOR CURB REG. CHECK 1 569.25 569.25CR 0.00 569.25 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!24!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 5 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-006054 CENTRAL ROOFING COMPANY I 2023-0370 RSMT LIFETIME ATHLETIC PROJ APBNK 10/12/2023 R 9/30/2023 20,000.00 20,000.00CR G/L ACCOUNT CK: 153549 20,000.00 476 48000-01-521.00 BUILDING & STRUCTURE PURCHASES 20,000.00 RSMT LIFETIME ATHLETIC PROJ REG. CHECK 1 20,000.00 20,000.00CR 0.00 20,000.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-030498 CENTRAL TURF & IRRIGATION S I 50260403-00 IRRIGATION PARTS APBNK 10/12/2023 R 10/04/2023 71.20 71.20CR G/L ACCOUNT CK: 153550 71.20 101 45202-01-221.00 EQUIPMENT PARTS 71.20 IRRIGATION PARTS REG. CHECK 1 71.20 71.20CR 0.00 71.20 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-000424 CERTIFIED RECYCLING LLC I 77424 DITCH TRASH DISPOSAL APBNK 10/12/2023 R 9/22/2023 220.00 220.00CR G/L ACCOUNT CK: 153551 220.00 101 43121-01-384.00 REFUSE DISPOSAL 220.00 DITCH TRASH DISPOSAL REG. CHECK 1 220.00 220.00CR 0.00 220.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-001576 CG MARKETING GROUP I 102784 BUILDING PERMIT - WINDOW CA APBNK 10/12/2023 R 9/28/2023 112.35 112.35CR G/L ACCOUNT CK: 153552 112.35 101 41810-01-203.00 PRINTED FORMS & PAPER 112.35 BUILDING PERMIT - WINDOW CARDS REG. CHECK 1 112.35 112.35CR 0.00 112.35 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-005542 CHARTER COMMUNICATIONS I 175314201092123 FIRE STATION 1 CABLE APBNK 10/12/2023 R 9/21/2023 10.52 10.52CR G/L ACCOUNT CK: 153553 10.52 101 42210-01-439.00 OTHER MISCELLANEOUS CHARGES 10.52 FIRE STATION 1 CABLE I 175314901092123 ARENA - TV BUNDLE APBNK 10/12/2023 R 9/21/2023 34.74 34.74CR G/L ACCOUNT CK: 153553 34.74 650 45130-01-404.00 CONTRACTED MACH & EQUIP R & M 34.74 ARENA - TV BUNDLE Qbhf!25!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 6 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ REG. CHECK 1 45.26 45.26CR 0.00 45.26 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-005760 CINTAS CORP I 5175026254 FIRST AID SUPPLIES APBNK 10/12/2023 R 9/12/2023 729.24 729.24CR G/L ACCOUNT CK: 153554 729.24 101 41940-01-208.00 MISCELLANEOUS SUPPLIES 729.24 FIRST AID SUPPLIES REG. CHECK 1 729.24 729.24CR 0.00 729.24 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-030784 CINTAS CORPORATION I 4168559590 MATS @ FS #2 APBNK 10/12/2023 R 9/21/2023 20.00 20.00CR G/L ACCOUNT CK: 153555 20.00 101 41940-01-319.00 OTHER PROFESSIONAL SERVICES 20.00 MATS @ FS #2 I 4168559650 MATS & TOWELS @ MAINT BLDG APBNK 10/12/2023 R 9/21/2023 42.75 42.75CR G/L ACCOUNT CK: 153555 42.75 101 41940-01-319.00 OTHER PROFESSIONAL SERVICES 9.00 MATS & TOWELS @ MAINT BLDG 101 43100-01-211.00 CLEANING SUPPLIES 33.75 MATS & TOWELS @ MAINT BLDG I 4168559679 MATS @ CARPENTER SHOP APBNK 10/12/2023 R 9/21/2023 22.75 22.75CR G/L ACCOUNT CK: 153555 22.75 101 41940-01-319.00 OTHER PROFESSIONAL SERVICES 22.75 MATS @ CARPENTER SHOP I 4168559743 MATS @ PW OFFICE BLDG APBNK 10/12/2023 R 9/21/2023 68.25 68.25CR G/L ACCOUNT CK: 153555 68.25 101 41940-01-319.00 OTHER PROFESSIONAL SERVICES 68.25 MATS @ PW OFFICE BLDG I 4168559829 MATS @ POLICE APBNK 10/12/2023 R 9/21/2023 48.75 48.75CR G/L ACCOUNT CK: 153555 48.75 101 41940-01-319.00 OTHER PROFESSIONAL SERVICES 48.75 MATS @ POLICE I 4168559862 MATS @ CITY HALL APBNK 10/12/2023 R 9/21/2023 86.25 86.25CR G/L ACCOUNT CK: 153555 86.25 101 41940-01-319.00 OTHER PROFESSIONAL SERVICES 86.25 MATS @ CITY HALL I 4168559881 MATS @ FS #1 APBNK 10/12/2023 R 9/21/2023 20.00 20.00CR G/L ACCOUNT CK: 153555 20.00 101 41940-01-319.00 OTHER PROFESSIONAL SERVICES 20.00 MATS @ FS #1 I 4169976676 MATS @ FS #2 APBNK 10/12/2023 R 10/05/2023 20.00 20.00CR G/L ACCOUNT CK: 153555 20.00 101 41940-01-319.00 OTHER PROFESSIONAL SERVICES 20.00 MATS @ FS #2 Qbhf!26!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 7 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ I 4169976687 MATS & TOWELS @ MAINT BLDG APBNK 10/12/2023 R 10/05/2023 42.75 42.75CR G/L ACCOUNT CK: 153555 42.75 101 41940-01-319.00 OTHER PROFESSIONAL SERVICES 9.00 MATS & TOWELS @ MAINT BLDG 101 43100-01-211.00 CLEANING SUPPLIES 33.75 MATS & TOWELS @ MAINT BLDG I 4169976743 MATS @ CARPENTER SHOP APBNK 10/12/2023 R 10/05/2023 22.75 22.75CR G/L ACCOUNT CK: 153555 22.75 101 41940-01-319.00 OTHER PROFESSIONAL SERVICES 22.75 MATS @ CARPENTER SHOP I 4169976753 MATS @ PW OFFICE BLDG APBNK 10/12/2023 R 10/05/2023 68.25 68.25CR G/L ACCOUNT CK: 153555 68.25 101 41940-01-319.00 OTHER PROFESSIONAL SERVICES 68.25 MATS @ PW OFFICE BLDG I 4169976833 MATS @ CITY HALL APBNK 10/12/2023 R 10/05/2023 62.25 62.25CR G/L ACCOUNT CK: 153555 62.25 101 41940-01-319.00 OTHER PROFESSIONAL SERVICES 62.25 MATS @ CITY HALL I 4169976847 MATS @ POLICE APBNK 10/12/2023 R 10/05/2023 48.75 48.75CR G/L ACCOUNT CK: 153555 48.75 101 41940-01-319.00 OTHER PROFESSIONAL SERVICES 48.75 MATS @ POLICE I 4169976859 MATS @ FS #1 APBNK 10/12/2023 R 10/05/2023 20.00 20.00CR G/L ACCOUNT CK: 153555 20.00 101 41940-01-319.00 OTHER PROFESSIONAL SERVICES 20.00 MATS @ FS #1 REG. CHECK 1 593.50 593.50CR 0.00 593.50 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-030908 CITY OF APPLE VALLEY I 7703 CABLE JPA OPERATIONS 4TH QT APBNK 10/12/2023 R 10/01/2023 23,193.75 23,193.75CR G/L ACCOUNT CK: 153557 23,193.75 101 41320-41-329.00 OTHER COMMUNICATION COSTS 23,193.75 CABLE JPA OPERATIONS 4TH QTR REG. CHECK 1 23,193.75 23,193.75CR 0.00 23,193.75 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-004694 CITY OF INVER GROVE HTS I 23-02A FIREFIGHTER II TRAINING APBNK 10/12/2023 R 9/07/2023 1,140.00 1,140.00CR G/L ACCOUNT CK: 153558 1,140.00 101 42210-01-308.00 INSTRUCTORS' FEES 1,140.00 FIREFIGHTER II TRAINING REG. CHECK 1 1,140.00 1,140.00CR 0.00 1,140.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!27!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 8 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-030956 CITY OF ROSEMOUNT I 2023-0392 SEPTEMBER 2023 STATE SURCHA APBNK 10/12/2023 R 10/09/2023 181.09 181.09CR G/L ACCOUNT CK: 153559 181.09 101 20810 BUILDING PERMIT SURCHARGE 170.59 SEPTEMBER 2023 STATE SURCHARGE 101 20811 BUILDING PMT SURCHARGE-SET FEE 5.04 SEPTEMBER 2023 STATE SURCHARGE 101 20820 ELECTRICAL PERMIT SURCHARGE 1.96 SEPTEMBER 2023 STATE SURCHARGE 101 20860 HEATING/AIR COND PERMIT SURCHG 1.18 SEPTEMBER 2023 STATE SURCHARGE 101 20830 PLUMBING PERMIT SURCHARGE 1.26 SEPTEMBER 2023 STATE SURCHARGE 101 20850 SEWER PERMIT SURCHARGE 1.06 SEPTEMBER 2023 STATE SURCHARGE REG. CHECK 1 181.09 181.09CR 0.00 181.09 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-030957 CITY OF ROSEMOUNT I 2023-0371 SEPT 2023 CITY SHARE SAC FE APBNK 10/12/2023 R 10/03/2023 4,796.05 4,796.05CR G/L ACCOUNT CK: 153560 4,796.05 101 20815 METRO SAC FOR MWCC 4,796.05 SEPT 2023 CITY SHARE SAC FEES REG. CHECK 1 4,796.05 4,796.05CR 0.00 4,796.05 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-030974 CITY OF ST PAUL I IN55552 PDI TRAINING COURSE APBNK 10/12/2023 R 9/21/2023 750.00 750.00CR G/L ACCOUNT CK: 153561 750.00 101 42110-01-437.00 CONFERENCES & SEMINARS 750.00 PDI TRAINING COURSE REG. CHECK 1 750.00 750.00CR 0.00 750.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-004599 CLEAN CHOICE ENERGY I INV200772876 AUGUST SOLAR SUBSCRIPTIONS APBNK 10/12/2023 R 10/02/2023 2,355.08 2,355.08CR G/L ACCOUNT CK: 153562 2,355.08 601 49407-01-381.00 ELECTRIC UTILITIES 969.83 AUGUST SOLAR SUBSCRIPTIONS 101 41940-01-381.00 ELECTRIC UTILITIES 246.07 AUGUST SOLAR SUBSCRIPTIONS 601 49410-01-381.00 ELECTRIC UTILITIES 1,139.18 AUGUST SOLAR SUBSCRIPTIONS REG. CHECK 1 2,355.08 2,355.08CR 0.00 2,355.08 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!28!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 9 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-004639 CLEARWAY COMMUNITY SOLAR LL I ROSEMNT-12309 JULY SOLAR SUBSCRIPTIONS APBNK 10/12/2023 R 9/18/2023 18,824.44 18,824.44CR G/L ACCOUNT CK: 153563 18,824.44 101 11510 NATIONAL GUARD A/R 11,561.65 JULY SOLAR SUBSCRIPTIONS 101 41940-01-381.00 ELECTRIC UTILITIES 310.69 JULY SOLAR SUBSCRIPTIONS 101 43121-01-381.00 ELECTRIC UTILITIES 50.63 JULY SOLAR SUBSCRIPTIONS 101 45100-01-381.00 ELECTRIC UTILITIES 4,955.00 JULY SOLAR SUBSCRIPTIONS 101 45202-01-381.00 ELECTRIC UTILITIES 208.34 JULY SOLAR SUBSCRIPTIONS 201 46300-01-381.00 ELECTRIC UTILITIES 6.94 JULY SOLAR SUBSCRIPTIONS 601 49406-01-381.00 ELECTRIC UTILITIES 267.37 JULY SOLAR SUBSCRIPTIONS 601 49417-01-381.00 ELECTRIC UTILITIES 519.47 JULY SOLAR SUBSCRIPTIONS 601 49418-01-381.00 ELECTRIC UTILITIES 463.62 JULY SOLAR SUBSCRIPTIONS 602 49452-01-381.00 ELECTRIC UTILITIES 72.53 JULY SOLAR SUBSCRIPTIONS 602 49458-01-381.00 ELECTRIC UTILITIES 43.30 JULY SOLAR SUBSCRIPTIONS 602 49460-01-381.00 ELECTRIC UTILITIES 26.19 JULY SOLAR SUBSCRIPTIONS 603 49511-01-381.00 ELECTRIC UTILITIES 15.19 JULY SOLAR SUBSCRIPTIONS 608 49508-01-381.00 ELECTRIC UTILITIES 323.52 JULY SOLAR SUBSCRIPTIONS REG. CHECK 1 18,824.44 18,824.44CR 0.00 18,824.44 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-004277 CORE & MAIN LP I T586816 AMI SYSTEM SETUP APBNK 10/12/2023 R 10/03/2023 7,957.00 7,957.00CR G/L ACCOUNT CK: 153565 7,957.00 601 49400-01-220.00 METER PURCHASES 7,957.00 AMI SYSTEM SETUP I T708952 8 MXUS SINGLE PORT APBNK 10/12/2023 R 10/05/2023 1,431.68 1,431.68CR G/L ACCOUNT CK: 153565 1,431.68 601 49400-01-220.00 METER PURCHASES 1,431.68 8 MXUS SINGLE PORT REG. CHECK 1 9,388.68 9,388.68CR 0.00 9,388.68 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-031577 CORPORATE MECHANICAL INC I W69348 SUMMER PREVENTATIVE MAINT-R APBNK 10/12/2023 R 9/20/2023 565.00 565.00CR G/L ACCOUNT CK: 153566 565.00 101 45100-01-404.00 CONTRACTED MACH & EQUIP R & M 565.00 SUMMER PREVENTATIVE MAINT-RCC I W69473 BH DUCT CONDENSATION APBNK 10/12/2023 R 9/25/2023 1,350.00 1,350.00CR G/L ACCOUNT CK: 153566 1,350.00 101 45100-01-404.00 CONTRACTED MACH & EQUIP R & M 1,350.00 BH DUCT CONDENSATION REG. CHECK 1 1,915.00 1,915.00CR 0.00 1,915.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!29!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 10 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-031880 CROWN RENTAL I 397254-2 LIFT RENTAL APBNK 10/12/2023 R 10/04/2023 190.00 190.00CR G/L ACCOUNT CK: 153567 190.00 101 41940-01-416.00 MACHINERY RENTAL 190.00 LIFT RENTAL REG. CHECK 1 190.00 190.00CR 0.00 190.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-005859 DAKOTA 911 I RO2023-11 NOV MONTHLY 911 FEE APBNK 10/12/2023 R 10/02/2023 34,690.00 34,690.00CR G/L ACCOUNT CK: 153568 34,690.00 101 42110-01-319.00 OTHER PROFESSIONAL SERVICES 34,690.00 NOV MONTHLY 911 FEE REG. CHECK 1 34,690.00 34,690.00CR 0.00 34,690.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-040040 DAKOTA AWARDS & ENGRAVING I 26786 NAME PLATE - MALECHA APBNK 10/12/2023 R 9/23/2023 12.00 12.00CR G/L ACCOUNT CK: 153569 12.00 101 41810-01-209.00 OTHER OFFICE SUPPLIES 12.00 NAME PLATE - MALECHA REG. CHECK 1 12.00 12.00CR 0.00 12.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-001935 DAKOTA COUNTY FINANCE I 5501184 800 MHZ RADIO SUBSCRIBER FE APBNK 10/12/2023 R 9/18/2023 3,219.54 3,219.54CR G/L ACCOUNT CK: 153570 3,219.54 101 42110-01-323.00 RADIO UNITS 1,213.16 800 MHZ RADIO SUBSCRIBER FEES 101 42210-01-329.00 OTHER COMMUNICATION COSTS 1,259.82 800 MHZ RADIO SUBSCRIBER FEES 101 43121-01-323.00 RADIO UNITS 149.31 800 MHZ RADIO SUBSCRIBER FEES 101 45202-01-323.00 RADIO UNITS 149.31 800 MHZ RADIO SUBSCRIBER FEES 601 49400-01-323.00 RADIO UNITS 149.31 800 MHZ RADIO SUBSCRIBER FEES 602 49450-01-323.00 RADIO UNITS 149.31 800 MHZ RADIO SUBSCRIBER FEES 603 49500-01-323.00 RADIO UNITS 149.32 800 MHZ RADIO SUBSCRIBER FEES REG. CHECK 1 3,219.54 3,219.54CR 0.00 3,219.54 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!2:!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 11 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-040435 DAKOTA ELECTRIC ASSOCIATION I 200002005379 9/23 JAYCEE PARK CONTROL BLDG APBNK 10/12/2023 R 9/27/2023 62.02 62.02CR G/L ACCOUNT CK: 153571 62.02 101 45202-01-381.00 ELECTRIC UTILITIES 62.02 JAYCEE PARK CONTROL BLDG I 200003157294 9/23 WENSMANN POND MONITORING ST APBNK 10/12/2023 R 9/27/2023 17.70 17.70CR G/L ACCOUNT CK: 153571 17.70 603 49513-01-381.00 ELECTRIC UTILITIES 17.70 WENSMANN POND MONITORING ST'N I 200003776226 9/23 SIREN #13 APBNK 10/12/2023 R 9/27/2023 24.15 24.15CR G/L ACCOUNT CK: 153571 24.15 101 43121-01-381.00 ELECTRIC UTILITIES 24.15 SIREN #13 I 200005601588 9/23 STORM DRAIN LIFT STATION #7 APBNK 10/12/2023 R 9/27/2023 30.49 30.49CR G/L ACCOUNT CK: 153571 30.49 603 49517-01-381.00 ELECTRIC UTILITIES 30.49 STORM DRAIN LIFT STATION #7 I 200010007317 9/23 WELL #16 APBNK 10/12/2023 R 9/27/2023 3,900.54 3,900.54CR G/L ACCOUNT CK: 153571 3,900.54 601 49426-01-381.00 ELECTRIC UTILITIES 3,900.54 WELL #16 I 200010050261 9/23 WELCOME SIGN - NORTH APBNK 10/12/2023 R 9/27/2023 17.41 17.41CR G/L ACCOUNT CK: 153571 17.41 608 49508-01-381.00 ELECTRIC UTILITIES 17.41 WELCOME SIGN - NORTH REG. CHECK 1 4,052.31 4,052.31CR 0.00 4,052.31 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-005839 DNS MADE EASY I 704930 CI.ROSEMOUNT.MN.US DNS APBNK 10/12/2023 R 10/05/2023 100.95 100.95CR G/L ACCOUNT CK: 153572 100.95 101 41810-01-392.00 P.C. ACCESSORIES & SUPPLIES 100.95 CI.ROSEMOUNT.MN.US DNS REG. CHECK 1 100.95 100.95CR 0.00 100.95 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-000316 DRAIN PRO-PLUMBING INC I 72652 URINAL CLOG APBNK 10/12/2023 R 10/03/2023 175.00 175.00CR G/L ACCOUNT CK: 153573 175.00 101 45100-01-404.00 CONTRACTED MACH & EQUIP R & M 175.00 URINAL CLOG REG. CHECK 1 175.00 175.00CR 0.00 175.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!31!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 12 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-050213 EARL F ANDERSEN INC I 0134008-IN SIGNS AND FLASHERS APBNK 10/12/2023 R 9/20/2023 462.10 462.10CR G/L ACCOUNT CK: 153574 462.10 101 43121-01-226.00 SIGN REPAIR MATERIALS 462.10 SIGNS AND FLASHERS I 0134102-IN ROAD WORK AHEAD SIGNS APBNK 10/12/2023 R 9/27/2023 356.95 356.95CR G/L ACCOUNT CK: 153574 356.95 101 43121-01-226.00 SIGN REPAIR MATERIALS 356.95 ROAD WORK AHEAD SIGNS REG. CHECK 1 819.05 819.05CR 0.00 819.05 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-050340 ECOLAB PEST I 2452215 BOX ELDER BUG TREATMENT APBNK 10/12/2023 R 10/04/2023 350.00 350.00CR G/L ACCOUNT CK: 153575 350.00 101 41940-01-319.00 OTHER PROFESSIONAL SERVICES 350.00 BOX ELDER BUG TREATMENT I 3441379 PEST CONTROL-MN DOT APBNK 10/12/2023 R 9/29/2023 46.16 46.16CR G/L ACCOUNT CK: 153575 46.16 101 41940-01-319.00 OTHER PROFESSIONAL SERVICES 46.16 PEST CONTROL-MN DOT I 3441380 PEST CONTROL-CH,SHOP,PW APBNK 10/12/2023 R 9/29/2023 132.73 132.73CR G/L ACCOUNT CK: 153575 132.73 101 41940-01-319.00 OTHER PROFESSIONAL SERVICES 132.73 PEST CONTROL-CH,SHOP,PW REG. CHECK 1 528.89 528.89CR 0.00 528.89 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-050812 EHLERS I 1221 2022 TIF REPORTING APBNK 10/12/2023 R 9/18/2023 132.50 132.50CR G/L ACCOUNT CK: 153576 132.50 242 49042-01-319.00 OTHER PROFESSIONAL SERVICES 132.50 2022 TIF REPORTING REG. CHECK 1 132.50 132.50CR 0.00 132.50 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-001139 ELECTRIC PUMP I 0076636-IN SPARE FLYGT GRINDER PUMP APBNK 10/12/2023 R 9/19/2023 4,588.88 4,588.88CR G/L ACCOUNT CK: 153577 4,588.88 602 49450-01-580.00 OTHER EQUIPMENT PURCHASES 4,588.88 SPARE FLYGT GRINDER PUMP Qbhf!32!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 13 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ REG. CHECK 1 4,588.88 4,588.88CR 0.00 4,588.88 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-051340 EMERGENCY AUTOMOTIVE TECH I OAK23143 UNIT 1 IN-HOUSE BUILD APBNK 10/12/2023 R 9/22/2023 2,498.82 2,498.82CR G/L ACCOUNT CK: 153578 2,498.82 207 49007-01-576.00 OTHER EQUIPMENT PURCHASES 2,498.82 UNIT 1 IN-HOUSE BUILD I OAK23144 UNIT 2 IN-HOUSE BUILD APBNK 10/12/2023 R 9/27/2023 2,498.82 2,498.82CR G/L ACCOUNT CK: 153578 2,498.82 207 49007-01-576.00 OTHER EQUIPMENT PURCHASES 2,498.82 UNIT 2 IN-HOUSE BUILD I OAK23145 UNIT 3 IN-HOUSE BUILD APBNK 10/12/2023 R 9/29/2023 2,498.82 2,498.82CR G/L ACCOUNT CK: 153578 2,498.82 207 49007-01-576.00 OTHER EQUIPMENT PURCHASES 2,498.82 UNIT 3 IN-HOUSE BUILD REG. CHECK 1 7,496.46 7,496.46CR 0.00 7,496.46 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-005731 EMERGENCY TECHNICAL DECON I 708 TURNOUT GEAR REPAIR & CLEAN APBNK 10/12/2023 R 5/23/2023 1,679.65 1,679.65CR G/L ACCOUNT CK: 153579 1,679.65 101 42210-01-580.00 OTHER EQUIPMENT PURCHASES 1,679.65 TURNOUT GEAR REPAIR & CLEANING REG. CHECK 1 1,679.65 1,679.65CR 0.00 1,679.65 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-006056 FINAL GRADE INC I 1005803 CONCRETE REPAIRS APBNK 10/12/2023 R 9/27/2023 7,537.50 7,537.50CR G/L ACCOUNT CK: 153580 7,537.50 203 49003-01-532.00 IMPROVEMENTS OTHER THAN BLDGS 7,537.50 CONCRETE REPAIRS REG. CHECK 1 7,537.50 7,537.50CR 0.00 7,537.50 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-060685 FIRE RELIEF ASSOCIATION I 2023-0374 2023 STATE FIRE & SUPPL. AI APBNK 10/12/2023 R 9/29/2023 215,185.96 215,185.96CR G/L ACCOUNT CK: 153581 215,185.96 101 11500 ACCOUNTS RECEIVABLE 182,076.59 2023 STATE FIRE & SUPPL. AID Qbhf!33!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 14 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 101 11500 ACCOUNTS RECEIVABLE 33,109.37 2023 STATE FIRE & SUPPL. AID REG. CHECK 1 215,185.96 215,185.96CR 0.00 215,185.96 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-060840 FIRST STATE BANK I 2023-0375 SAFE DEPOSIT BOX RENTAL #98 APBNK 10/12/2023 R 9/25/2023 75.00 75.00CR G/L ACCOUNT CK: 153582 75.00 101 41520-01-409.00 OTHER CONTRACTED REPAIR & MAIN 75.00 SAFE DEPOSIT BOX RENTAL #989 REG. CHECK 1 75.00 75.00CR 0.00 75.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-005768 FP MAILING SOLUTIONS I 2023-0376 9/29 POSTAGE MACHINE REFILL APBNK 10/02/2023 D 9/29/2023 800.00 800.00CR G/L ACCOUNT CK: 001651 800.00 101 41810-01-322.00 POSTAGE COSTS 800.00 9/29 POSTAGE MACHINE REFILL DRAFTS 1 800.00 800.00CR 0.00 800.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-061865 FRONTIER I 651-188-0017 10/23 PHONE,INTERNET & CITY WIFI APBNK 10/12/2023 R 9/25/2023 4,586.92 4,586.92CR G/L ACCOUNT CK: 153583 4,586.92 101 41810-01-321.00 TELEPHONE COSTS 4,215.71 PHONE,INTERNET & CITY WIFI SRV 601 49407-01-321.00 TELEPHONE COSTS 17.57 PHONE,INTERNET & CITY WIFI SRV 601 49410-01-321.00 TELEPHONE COSTS 63.73 PHONE,INTERNET & CITY WIFI SRV 601 49400-01-321.00 TELEPHONE COSTS 68.85 PHONE,INTERNET & CITY WIFI SRV 602 49450-01-321.00 TELEPHONE COSTS 68.85 PHONE,INTERNET & CITY WIFI SRV 603 49500-01-321.00 TELEPHONE COSTS 68.88 PHONE,INTERNET & CITY WIFI SRV 650 45130-01-321.00 TELEPHONE COSTS 83.33 PHONE,INTERNET & CITY WIFI SRV REG. CHECK 1 4,586.92 4,586.92CR 0.00 4,586.92 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-003113 GAME TIME I PJI-0218213 PLAYGROUND PARTS APBNK 10/12/2023 R 9/21/2023 2,803.51 2,803.51CR G/L ACCOUNT CK: 153584 2,803.51 101 45202-01-221.00 EQUIPMENT PARTS 2,803.51 PLAYGROUND PARTS REG. CHECK 1 2,803.51 2,803.51CR 0.00 2,803.51 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!34!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 15 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-000677 GERTENS I 211421/12 FERTILIZER AND SEED APBNK 10/12/2023 R 10/06/2023 117.80 117.80CR G/L ACCOUNT CK: 153585 117.80 101 45202-01-225.00 LANDSCAPING MATERIALS 117.80 FERTILIZER AND SEED REG. CHECK 1 117.80 117.80CR 0.00 117.80 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-003610 GIGABIT MINNESOTA I 13965129 1000 MBPS FIBER INTERNET-OC APBNK 10/03/2023 D 10/01/2023 800.00 800.00CR G/L ACCOUNT CK: 001652 800.00 101 41810-01-321.00 TELEPHONE COSTS 800.00 1000 MBPS FIBER INTERNET-OCT DRAFTS 1 800.00 800.00CR 0.00 800.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-004158 GILBERT MECHANICAL CONTRACT I 61569 REPLACE 3 RTU @ FS #2 APBNK 10/12/2023 R 9/19/2023 21,561.00 21,561.00CR G/L ACCOUNT CK: 153586 21,561.00 101 24429 F/B ASSIGNED FOR GOVT BLDG R&M 21,561.00 REPLACE 3 RTU @ FS #2 REG. CHECK 1 21,561.00 21,561.00CR 0.00 21,561.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-006038 GLOBAL SPECIALTY CONTRACTOR I 2023-0377 RSMT LIFETIME ATHLETIC PROJ APBNK 10/12/2023 R 9/15/2023 254,837.50 254,837.50CR G/L ACCOUNT CK: 153587 254,837.50 476 48000-01-521.00 BUILDING & STRUCTURE PURCHASES 254,837.50 RSMT LIFETIME ATHLETIC PROJ REG. CHECK 1 254,837.50 254,837.50CR 0.00 254,837.50 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-003447 GOPHER STAGE LIGHTING I INV22441 STAGE CURTAIN SERVICE APBNK 10/12/2023 R 9/28/2023 1,200.00 1,200.00CR G/L ACCOUNT CK: 153588 1,200.00 101 45100-30-404.00 CONTRACTED MACH & EQUIP R & M 1,200.00 STAGE CURTAIN SERVICE REG. CHECK 1 1,200.00 1,200.00CR 0.00 1,200.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!35!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 16 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-070880 GOPHER STATE ONE-CALL I 3090720 SEPTEMBER TICKET LOCATES APBNK 10/12/2023 R 9/30/2023 587.25 587.25CR G/L ACCOUNT CK: 153589 587.25 603 49500-01-312.00 GOPHER STATE ONE-CALL FEES 195.75 SEPTEMBER TICKET LOCATES 601 49400-01-312.00 GOPHER STATE ONE-CALL FEES 195.75 SEPTEMBER TICKET LOCATES 602 49450-01-312.00 GOPHER STATE ONE-CALL FEES 195.75 SEPTEMBER TICKET LOCATES REG. CHECK 1 587.25 587.25CR 0.00 587.25 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-070935 GOV'T FIN OFFICERS ASS'N I 279267 GFOA MEMBERSHIP DUES-RAABOL APBNK 10/12/2023 R 9/11/2023 150.00 150.00CR G/L ACCOUNT CK: 153590 150.00 101 41320-01-433.00 DUES & SUBSCRIPTIONS 150.00 GFOA MEMBERSHIP DUES-RAABOLLE REG. CHECK 1 150.00 150.00CR 0.00 150.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-071220 GRAINGER I 9842809585 BH CEILING TILES APBNK 10/12/2023 R 9/19/2023 321.66 321.66CR G/L ACCOUNT CK: 153591 321.66 101 45100-01-223.00 BUILDING REPAIR SUPPLIES 321.66 BH CEILING TILES REG. CHECK 1 321.66 321.66CR 0.00 321.66 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-080050 HACH COMPANY I 13754277 DPD FREE BULK DISPENSER APBNK 10/12/2023 R 9/26/2023 172.90 172.90CR G/L ACCOUNT CK: 153592 172.90 601 49400-01-216.00 CHEMICALS & CHEMICAL PRODUCTS 172.90 DPD FREE BULK DISPENSER REG. CHECK 1 172.90 172.90CR 0.00 172.90 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-006057 HARTY MECHANICAL INC I 2023-0378 RSMT LIFETIME ATHLETIC PROJ APBNK 10/12/2023 R 9/25/2023 306,850.00 306,850.00CR G/L ACCOUNT CK: 153593 306,850.00 476 48000-01-521.00 BUILDING & STRUCTURE PURCHASES 306,850.00 RSMT LIFETIME ATHLETIC PROJ Qbhf!36!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 17 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ REG. CHECK 1 306,850.00 306,850.00CR 0.00 306,850.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-080905 HIGHLAND SANITATION I 0001141597 FOOD TRUCK TRASH/RECYCLING APBNK 10/12/2023 R 9/23/2023 685.00 685.00CR G/L ACCOUNT CK: 153594 685.00 101 45100-01-315.00 SPECIAL PROGRAMS 685.00 FOOD TRUCK TRASH/RECYCLING I 0001141678 SEPTEMBER TRASH REMOVAL APBNK 10/12/2023 R 9/23/2023 3,903.47 3,903.47CR G/L ACCOUNT CK: 153594 3,903.47 101 45100-01-384.00 REFUSAL DISPOSAL 231.15 SEPTEMBER TRASH REMOVAL 650 45130-01-384.00 REFUSE DISPOSAL 217.95 SEPTEMBER TRASH REMOVAL 101 45100-01-315.00 SPECIAL PROGRAMS 49.00 SEPTEMBER TRASH REMOVAL 101 45100-30-384.00 REFUSE DISPOSAL 64.59 SEPTEMBER TRASH REMOVAL 101 41940-01-384.00 REFUSE DISPOSAL 3,340.78 SEPTEMBER TRASH REMOVAL REG. CHECK 1 4,588.47 4,588.47CR 0.00 4,588.47 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-004339 I & S GROUP INC I 97098 CONSTRUCTION DOCUMENTS APBNK 10/12/2023 R 9/30/2023 2,333.75 2,333.75CR G/L ACCOUNT CK: 153595 2,333.75 205 49005-01-537.00 IMPROVEMENTS OTHER THAN BLDGS 2,333.75 CONSTRUCTION DOCUMENTS REG. CHECK 1 2,333.75 2,333.75CR 0.00 2,333.75 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-003122 I STATE TRUCK CENTER I C242845199:01 LOCK SWITCH APBNK 10/12/2023 R 9/26/2023 51.63 51.63CR G/L ACCOUNT CK: 153596 51.63 101 43100-01-221.00 EQUIPMENT PARTS 51.63 LOCK SWITCH REG. CHECK 1 51.63 51.63CR 0.00 51.63 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-001690 IN CONTROL INC I S-INV00979 LIFT STATION 6 CONTROL PANE APBNK 10/12/2023 R 10/03/2023 5,007.20 5,007.20CR G/L ACCOUNT CK: 153597 5,007.20 602 49450-01-530.00 IMPROVEMENTS OTHER THAN BLDGS 5,007.20 LIFT STATION 6 CONTROL PANEL Qbhf!37!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 18 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ I S-INV00980 LIFT STATION 9 CONTROL PANA APBNK 10/12/2023 R 10/03/2023 6,230.90 6,230.90CR G/L ACCOUNT CK: 153597 6,230.90 602 49450-01-530.00 IMPROVEMENTS OTHER THAN BLDGS 6,230.90 LIFT STATION 9 CONTROL PANAL REG. CHECK 1 11,238.10 11,238.10CR 0.00 11,238.10 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-091405 INDEPENDENT BLACK DIRT I 34719 2 YDS BLACK DIRT APBNK 10/12/2023 R 10/06/2023 42.00 42.00CR G/L ACCOUNT CK: 153598 42.00 101 43121-01-225.00 LANDSCAPING MATERIALS 42.00 2 YDS BLACK DIRT REG. CHECK 1 42.00 42.00CR 0.00 42.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-001515 INVER GROVE FORD I 6395054 PARTS AND LABOR APBNK 10/12/2023 R 9/26/2023 883.76 883.76CR G/L ACCOUNT CK: 153599 883.76 101 43100-01-404.00 CONTRACTED MACH & EQUIP SERV 819.50 PARTS AND LABOR 101 43100-01-221.00 EQUIPMENT PARTS 64.26 PARTS AND LABOR I 6400125 WHEEL ALIGNMENT LABOR APBNK 10/12/2023 R 9/26/2023 209.95 209.95CR G/L ACCOUNT CK: 153599 209.95 101 43100-01-404.00 CONTRACTED MACH & EQUIP SERV 209.95 WHEEL ALIGNMENT LABOR REG. CHECK 1 1,093.71 1,093.71CR 0.00 1,093.71 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-110314 KENNEDY & GRAVEN CHARTERED I 176877 LIFETIME LEGAL FEES APBNK 10/12/2023 R 9/26/2023 338.00 338.00CR G/L ACCOUNT CK: 153600 338.00 202 49002-01-304.00 LEGAL FEES 338.00 LIFETIME LEGAL FEES REG. CHECK 1 338.00 338.00CR 0.00 338.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!38!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 19 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-111843 KRISS PREMIUM PRODUCTS I 185259 COOLING TREATMENT APBNK 10/12/2023 R 9/25/2023 1,006.00 1,006.00CR G/L ACCOUNT CK: 153601 1,006.00 650 45130-01-216.00 CHEMICALS & CHEMICAL PRODUCTS 1,006.00 COOLING TREATMENT REG. CHECK 1 1,006.00 1,006.00CR 0.00 1,006.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-006039 LEJEUNE STEEL COMPANY I 2023-0379 RSMT LIFETIME ATHLETIC PROJ APBNK 10/12/2023 R 9/30/2023 444,600.00 444,600.00CR G/L ACCOUNT CK: 153602 444,600.00 476 48000-01-521.00 BUILDING & STRUCTURE PURCHASES 444,600.00 RSMT LIFETIME ATHLETIC PROJ REG. CHECK 1 444,600.00 444,600.00CR 0.00 444,600.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-001511 LENNAR HOMES I 2018-00804 AS-BUILT SURVEY REFUND APBNK 10/12/2023 R 9/28/2023 2,000.00 2,000.00CR G/L ACCOUNT CK: 153603 2,000.00 101 22010 AS-BUILT SURVEY DEPOSITS 2,000.00 AS-BUILT SURVEY REFUND I 2018-02063 AS-BUILT SURVEY REFUND APBNK 10/12/2023 R 10/03/2023 2,000.00 2,000.00CR G/L ACCOUNT CK: 153603 2,000.00 101 22010 AS-BUILT SURVEY DEPOSITS 2,000.00 AS-BUILT SURVEY REFUND I 2018-02065 AS-BUILT SURVEY REFUND APBNK 10/12/2023 R 10/03/2023 2,000.00 2,000.00CR G/L ACCOUNT CK: 153603 2,000.00 101 22010 AS-BUILT SURVEY DEPOSITS 2,000.00 AS-BUILT SURVEY REFUND I 2018-03161 AS-BUILT SURVEY REFUND APBNK 10/12/2023 R 9/28/2023 2,000.00 2,000.00CR G/L ACCOUNT CK: 153603 2,000.00 101 22010 AS-BUILT SURVEY DEPOSITS 2,000.00 AS-BUILT SURVEY REFUND I 2019-03529 AS-BUILT SURVEY REFUND APBNK 10/12/2023 R 9/28/2023 2,000.00 2,000.00CR G/L ACCOUNT CK: 153603 2,000.00 101 22010 AS-BUILT SURVEY DEPOSITS 2,000.00 AS-BUILT SURVEY REFUND I 2019-03530 AS-BUILT SURVEY REFUND APBNK 10/12/2023 R 9/28/2023 2,000.00 2,000.00CR G/L ACCOUNT CK: 153603 2,000.00 101 22010 AS-BUILT SURVEY DEPOSITS 2,000.00 AS-BUILT SURVEY REFUND I 2020-01202 AS-BUILT SURVEY REFUND APBNK 10/12/2023 R 9/28/2023 2,000.00 2,000.00CR G/L ACCOUNT CK: 153603 2,000.00 101 22010 AS-BUILT SURVEY DEPOSITS 2,000.00 AS-BUILT SURVEY REFUND Qbhf!39!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 20 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ I 2020-01309 AS-BUILT SURVEY REFUND APBNK 10/12/2023 R 9/28/2023 2,000.00 2,000.00CR G/L ACCOUNT CK: 153603 2,000.00 101 22010 AS-BUILT SURVEY DEPOSITS 2,000.00 AS-BUILT SURVEY REFUND I 2020-02287 AS-BUILT SURVEY REFUND APBNK 10/12/2023 R 9/28/2023 2,000.00 2,000.00CR G/L ACCOUNT CK: 153603 2,000.00 101 22010 AS-BUILT SURVEY DEPOSITS 2,000.00 AS-BUILT SURVEY REFUND I 2023-00487 AS-BUILT SURVEY REFUND APBNK 10/12/2023 R 10/03/2023 2,000.00 2,000.00CR G/L ACCOUNT CK: 153603 2,000.00 101 22010 AS-BUILT SURVEY DEPOSITS 2,000.00 AS-BUILT SURVEY REFUND REG. CHECK 1 20,000.00 20,000.00CR 0.00 20,000.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-001905 LEXISNEXIS RISK SOLNS FL IN I 1843662-20230930 SEPT MONTHLY FEE APBNK 10/12/2023 R 9/30/2023 658.67 658.67CR G/L ACCOUNT CK: 153605 658.67 101 42110-01-433.00 DUES & SUBSCRIPTIONS 658.67 SEPT MONTHLY FEE REG. CHECK 1 658.67 658.67CR 0.00 658.67 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-121530 LOGIS-LOCAL GOVERNMENT I 54035 OCT'23 APP SUPPORT/FIBER SV APBNK 10/12/2023 R 10/01/2023 3,265.33 3,265.33CR G/L ACCOUNT CK: 153606 3,265.33 101 42110-01-394.00 P.C. SOFTWARE PURCHASES 2,210.00 OCT'23 APP SUPPORT/FIBER SVCS 101 42110-01-394.00 P.C. SOFTWARE PURCHASES 381.00 OCT'23 APP SUPPORT/FIBER SVCS 101 42210-01-329.00 OTHER COMMUNICATION COSTS 248.00 OCT'23 APP SUPPORT/FIBER SVCS 101 41810-01-391.00 P.C. MAINTENANCE 426.33 OCT'23 APP SUPPORT/FIBER SVCS REG. CHECK 1 3,265.33 3,265.33CR 0.00 3,265.33 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-006021 LTF CONSTRUCTION COMPANY LL I 2023-0380 GENERAL CONDITIONS LT PROJE APBNK 10/12/2023 R 9/30/2023 185,000.00 185,000.00CR G/L ACCOUNT CK: 153607 185,000.00 476 48000-01-521.00 BUILDING & STRUCTURE PURCHASES 185,000.00 GENERAL CONDITIONS LT PROJECT REG. CHECK 1 185,000.00 185,000.00CR 0.00 185,000.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!3:!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 21 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-004207 LVC COMPANIES I 124162 SEMI-ANNUAL INSPEC/MAINT-SC APBNK 10/12/2023 R 9/28/2023 129.00 129.00CR G/L ACCOUNT CK: 153608 129.00 101 45100-30-404.00 CONTRACTED MACH & EQUIP R & M 129.00 SEMI-ANNUAL INSPEC/MAINT-SC REG. CHECK 1 129.00 129.00CR 0.00 129.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-006058 M/I HOMES I 2022-04907 AS-BUILT SURVEY REFUND APBNK 10/12/2023 R 9/28/2023 2,000.00 2,000.00CR G/L ACCOUNT CK: 153609 2,000.00 101 22010 AS-BUILT SURVEY DEPOSITS 2,000.00 AS-BUILT SURVEY REFUND I 2022-04951 AS-BUILT SURVEY REFUND APBNK 10/12/2023 R 10/03/2023 2,000.00 2,000.00CR G/L ACCOUNT CK: 153609 2,000.00 101 22010 AS-BUILT SURVEY DEPOSITS 2,000.00 AS-BUILT SURVEY REFUND I 2022-05028 AS-BUILT SURVEY REFUND APBNK 10/12/2023 R 9/28/2023 2,000.00 2,000.00CR G/L ACCOUNT CK: 153609 2,000.00 101 22010 AS-BUILT SURVEY DEPOSITS 2,000.00 AS-BUILT SURVEY REFUND I 2023-01589 AS-BUILT SURVEY REFUND APBNK 10/12/2023 R 9/28/2023 2,000.00 2,000.00CR G/L ACCOUNT CK: 153609 2,000.00 101 22010 AS-BUILT SURVEY DEPOSITS 2,000.00 AS-BUILT SURVEY REFUND REG. CHECK 1 8,000.00 8,000.00CR 0.00 8,000.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-004303 MACQUEEN EMERGENCY I P19709 FIRE HELMETS & CRESCENTS APBNK 10/12/2023 R 9/13/2023 2,037.53 2,037.53CR G/L ACCOUNT CK: 153610 2,037.53 101 42210-01-219.00 OTHER OPERATING SUPPLIES 2,037.53 FIRE HELMETS & CRESCENTS I P19748 CAPT/LT CRESCENTS APBNK 10/12/2023 R 9/14/2023 112.86 112.86CR G/L ACCOUNT CK: 153610 112.86 101 42210-01-219.00 OTHER OPERATING SUPPLIES 112.86 CAPT/LT CRESCENTS REG. CHECK 1 2,150.39 2,150.39CR 0.00 2,150.39 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!41!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 22 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-003535 MANSFIELD OIL COMPANY I 24671280 1,803 GAL DIESEL FUEL APBNK 10/12/2023 R 9/29/2023 6,435.69 6,435.69CR G/L ACCOUNT CK: 153611 6,435.69 101 43100-01-212.00 MOTOR FUELS 6,435.69 1,803 GAL DIESEL FUEL I 24687586 2,700 GAL UNLEADED FUEL APBNK 10/12/2023 R 10/05/2023 7,725.36 7,725.36CR G/L ACCOUNT CK: 153611 7,725.36 101 43100-01-212.00 MOTOR FUELS 7,725.36 2,700 GAL UNLEADED FUEL I 24687588 199 GAL UNLEADED FUEL APBNK 10/12/2023 R 10/05/2023 588.55 588.55CR G/L ACCOUNT CK: 153611 588.55 101 43100-01-212.00 MOTOR FUELS 588.55 199 GAL UNLEADED FUEL REG. CHECK 1 14,749.60 14,749.60CR 0.00 14,749.60 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-130280 MASTER ELECTRIC CO INC I SD47810 BOOSTER PUMP INSPECTION APBNK 10/12/2023 R 9/29/2023 490.00 490.00CR G/L ACCOUNT CK: 153612 490.00 601 49408-01-409.00 OTHER CONTRACTED REPAIR & MAIN 490.00 BOOSTER PUMP INSPECTION REG. CHECK 1 490.00 490.00CR 0.00 490.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-003592 MCMULLEN INSPECTIONS INC I 2023-0381 AUG-ELECTRICAL INSPECTIONS APBNK 10/12/2023 R 9/27/2023 9,241.40 9,241.40CR G/L ACCOUNT CK: 153613 9,241.40 101 20825 ELEC INSPCTR SHARE OF PMT FEES 9,241.40 AUG-ELECTRICAL INSPECTIONS I 2023-0382 SEPT-ELECTRICAL INSPECTIONS APBNK 10/12/2023 R 10/01/2023 12,753.20 12,753.20CR G/L ACCOUNT CK: 153613 12,753.20 101 20825 ELEC INSPCTR SHARE OF PMT FEES 12,753.20 SEPT-ELECTRICAL INSPECTIONS REG. CHECK 1 21,994.60 21,994.60CR 0.00 21,994.60 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-001863 MEDICINE LAKE TOURS I 2023-0383 SENIOR BUS TRIP APBNK 10/12/2023 R 9/28/2023 1,479.00 1,479.00CR G/L ACCOUNT CK: 153614 1,479.00 101 45100-87-219.00 OTHER OPERATING SUPPLIES 1,479.00 SENIOR BUS TRIP Qbhf!42!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 23 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ REG. CHECK 1 1,479.00 1,479.00CR 0.00 1,479.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-136955 MEI TOTAL ELEVATOR SOLUTION I 1041103 OCTOBER ELEVATOR INSPECTION APBNK 10/12/2023 R 10/01/2023 182.58 182.58CR G/L ACCOUNT CK: 153615 182.58 101 41940-01-319.00 OTHER PROFESSIONAL SERVICES 182.58 OCTOBER ELEVATOR INSPECTION REG. CHECK 1 182.58 182.58CR 0.00 182.58 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-130725 MENARDS-APPLE VALLEY I 61998 DEF FLUID APBNK 10/12/2023 R 9/21/2023 56.88 56.88CR G/L ACCOUNT CK: 153616 56.88 101 42210-01-229.00 OTHER MAINTENANCE SUPPLIES 56.88 DEF FLUID I 62386 CONCRETE APBNK 10/12/2023 R 9/29/2023 47.88 47.88CR G/L ACCOUNT CK: 153616 47.88 205 49005-01-530.00 IMPROVEMENTS OTHER THAN BLDGS 47.88 CONCRETE REG. CHECK 1 104.76 104.76CR 0.00 104.76 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-130975 METRO COUNCIL ENV SERV I 1163233 WASTEWATER SERVICE-NOVEMBER APBNK 10/12/2023 R 10/02/2023 137,777.63 137,777.63CR G/L ACCOUNT CK: 153617 137,777.63 602 49450-01-602.00 METRO SEWER SERVICE CHARGES 137,777.63 WASTEWATER SERVICE-NOVEMBER REG. CHECK 1 137,777.63 137,777.63CR 0.00 137,777.63 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-131025 METRO COUNCIL ENV SERV I 2023-0372 SEPT 2023 METRO SAC FEES APBNK 10/12/2023 R 10/03/2023 474,808.95 474,808.95CR G/L ACCOUNT CK: 153618 474,808.95 101 20815 METRO SAC FOR MWCC 474,808.95 SEPT 2023 METRO SAC FEES REG. CHECK 1 474,808.95 474,808.95CR 0.00 474,808.95 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!43!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 24 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-004079 METRO SALES INC I INV2377042 C6004 COPIER USAGE COSTS APBNK 10/12/2023 R 10/02/2023 367.31 367.31CR G/L ACCOUNT CK: 153619 367.31 101 41810-01-202.00 DUPLICATING & COPYING COSTS 367.31 C6004 COPIER USAGE COSTS REG. CHECK 1 367.31 367.31CR 0.00 367.31 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-001288 MIDLAND GLASS CO I 2023-0384 RSMT LIFETIME ATHLETIC PROJ APBNK 10/12/2023 R 9/30/2023 118,750.00 118,750.00CR G/L ACCOUNT CK: 153620 118,750.00 476 48000-01-521.00 BUILDING & STRUCTURE PURCHASES 118,750.00 RSMT LIFETIME ATHLETIC PROJ REG. CHECK 1 118,750.00 118,750.00CR 0.00 118,750.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-132085 MIDWEST PLAYSCAPES INC I 10271 SWING HANGERS W/HARDWARE APBNK 10/12/2023 R 9/25/2023 1,088.69 1,088.69CR G/L ACCOUNT CK: 153621 1,088.69 101 45202-01-221.00 EQUIPMENT PARTS 1,088.69 SWING HANGERS W/HARDWARE REG. CHECK 1 1,088.69 1,088.69CR 0.00 1,088.69 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-004744 MINDFUL HEALTH I 2023-0385 SEPT SENIOR YOGA CLASSES APBNK 10/12/2023 R 9/28/2023 312.00 312.00CR G/L ACCOUNT CK: 153622 312.00 101 45100-93-219.00 OTHER OPERATING SUPPLIES 312.00 SEPT SENIOR YOGA CLASSES REG. CHECK 1 312.00 312.00CR 0.00 312.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-003165 MINNESOTA LOCKS I 101127595 REPAIR VENDING MACH-PW APBNK 10/12/2023 R 9/20/2023 202.91 202.91CR G/L ACCOUNT CK: 153623 202.91 101 41810-01-260.00 FOOD FOR RESALE 202.91 REPAIR VENDING MACH-PW REG. CHECK 1 202.91 202.91CR 0.00 202.91 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!44!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 25 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-138040 MIRACLE RECREATION I 864547 KIDDER PLAYGROUND REPLACEME APBNK 10/12/2023 R 9/27/2023 74,179.87 74,179.87CR G/L ACCOUNT CK: 153624 74,179.87 101 24430 F/B ASSIGNED FOR PARK MAIN R&M 74,179.87 KIDDER PLAYGROUND REPLACEMENT REG. CHECK 1 74,179.87 74,179.87CR 0.00 74,179.87 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-136665 MN DEPT OF AGRICULTURE I 2023-0386 APP FEE FOR CHANGE IN LICEN APBNK 10/12/2023 R 9/29/2023 10.00 10.00CR G/L ACCOUNT CK: 153625 10.00 101 45202-01-433.00 DUES & SUBSCRIPTIONS 10.00 APP FEE FOR CHANGE IN LICENSE REG. CHECK 1 10.00 10.00CR 0.00 10.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-040600 MN DEPT OF LABOR & INDUSTRY I 2023-0393 SEPTEMBER 2023 STATE SURCHA APBNK 10/12/2023 R 10/09/2023 8,873.47 8,873.47CR G/L ACCOUNT CK: 153626 8,873.47 101 20810 BUILDING PERMIT SURCHARGE 8,358.97 SEPTEMBER 2023 STATE SURCHARG 101 20811 BUILDING PMT SURCHARGE-SET FEE 246.96 SEPTEMBER 2023 STATE SURCHARG 101 20820 ELECTRICAL PERMIT SURCHARGE 96.04 SEPTEMBER 2023 STATE SURCHARG 101 20860 HEATING/AIR COND PERMIT SURCHG 57.82 SEPTEMBER 2023 STATE SURCHARG 101 20830 PLUMBING PERMIT SURCHARGE 61.74 SEPTEMBER 2023 STATE SURCHARG 101 20850 SEWER PERMIT SURCHARGE 51.94 SEPTEMBER 2023 STATE SURCHARG REG. CHECK 1 8,873.47 8,873.47CR 0.00 8,873.47 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-003882 MN OCC HEALTH - LOCKBOX 135 I 438938 PRE-EMPLOYMENT SCREENINGS APBNK 10/12/2023 R 9/29/2023 316.00 316.00CR G/L ACCOUNT CK: 153627 316.00 101 41320-31-305.00 MEDICAL & DENTAL FEES 316.00 PRE-EMPLOYMENT SCREENINGS REG. CHECK 1 316.00 316.00CR 0.00 316.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!45!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 26 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-137465 MN RECREATION & PARK ASSO I 02563 BUILDING ATTENDANT JOB POST APBNK 10/12/2023 R 9/21/2023 125.00 125.00CR G/L ACCOUNT CK: 153628 125.00 101 45100-01-433.00 DUES & SUBSCRIPTIONS 125.00 BUILDING ATTENDANT JOB POSTING REG. CHECK 1 125.00 125.00CR 0.00 125.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-003522 MULTI-SERVICES INC I 50847 OCTOBER CLEANING SERVICE APBNK 10/12/2023 R 10/01/2023 5,550.00 5,550.00CR G/L ACCOUNT CK: 153629 5,550.00 101 41940-01-319.00 OTHER PROFESSIONAL SERVICES 5,550.00 OCTOBER CLEANING SERVICE REG. CHECK 1 5,550.00 5,550.00CR 0.00 5,550.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-006048 MUSKA ELECTRIC COMPANY I 2023-0387 RSMT LIFETIME ATHLETIC PROJ APBNK 10/12/2023 R 9/30/2023 285,000.00 285,000.00CR G/L ACCOUNT CK: 153630 285,000.00 476 48000-01-521.00 BUILDING & STRUCTURE PURCHASES 285,000.00 RSMT LIFETIME ATHLETIC PROJ REG. CHECK 1 285,000.00 285,000.00CR 0.00 285,000.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-005570 ON THE SPOT DETAIL I 023696 DETAILING 2 DURANGOS APBNK 10/12/2023 R 9/26/2023 300.00 300.00CR G/L ACCOUNT CK: 153631 300.00 101 42110-01-211.00 CLEANING SUPPLIES 300.00 DETAILING 2 DURANGOS REG. CHECK 1 300.00 300.00CR 0.00 300.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-004740 PELLICCI ACE ROSEMOUNT I 10736/R EXTRA KEYS FOR JAYCEE SHED APBNK 10/12/2023 R 9/21/2023 11.96 11.96CR G/L ACCOUNT CK: 153632 11.96 101 45202-01-221.00 EQUIPMENT PARTS 11.96 EXTRA KEYS FOR JAYCEE SHED I 10763/R PAINT MIXER SWITCH APBNK 10/12/2023 R 9/26/2023 7.99 7.99CR G/L ACCOUNT CK: 153632 7.99 101 45202-01-221.00 EQUIPMENT PARTS 7.99 PAINT MIXER SWITCH Qbhf!46!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 27 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ I 10817/R WOOD DOWELS APBNK 10/12/2023 R 10/05/2023 25.97 25.97CR G/L ACCOUNT CK: 153632 25.97 101 45202-01-221.00 EQUIPMENT PARTS 25.97 WOOD DOWELS I 10819/R MISC SHOP TOOLS APBNK 10/12/2023 R 10/06/2023 66.97 66.97CR G/L ACCOUNT CK: 153632 66.97 101 45202-01-241.00 SMALL TOOLS 66.97 MISC SHOP TOOLS REG. CHECK 1 112.89 112.89CR 0.00 112.89 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-004766 STACEY POPP I 2023-0390 SEPT SENIOR YOGA CLASSES APBNK 10/12/2023 R 9/26/2023 264.00 264.00CR G/L ACCOUNT CK: 153633 264.00 101 45100-93-219.00 OTHER OPERATING SUPPLIES 264.00 SEPT SENIOR YOGA CLASSES REG. CHECK 1 264.00 264.00CR 0.00 264.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-180060 R & R SPECIALTIES OF WI I 0079970-IN BLADE SHARPENING APBNK 10/12/2023 R 10/02/2023 40.00 40.00CR G/L ACCOUNT CK: 153634 40.00 650 45130-01-221.00 EQUIPMENT PARTS 40.00 BLADE SHARPENING REG. CHECK 1 40.00 40.00CR 0.00 40.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-006059 R.CUP I 001536 R.CUPS USED @ FOOD TRUCK FE APBNK 10/12/2023 R 9/29/2023 1,192.80 1,192.80CR G/L ACCOUNT CK: 153635 1,192.80 101 41940-01-384.00 REFUSE DISPOSAL 1,192.80 R.CUPS USED @ FOOD TRUCK FEST REG. CHECK 1 1,192.80 1,192.80CR 0.00 1,192.80 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-002910 RCM SPECIALTIES INC I 9281 SPRAY PATCH HIGH IRON APBNK 10/12/2023 R 9/29/2023 5,962.00 5,962.00CR G/L ACCOUNT CK: 153636 5,962.00 101 43121-01-408.00 CRACKSEAL,SEALC'T,PATCH,STRIP 5,962.00 SPRAY PATCH HIGH IRON Qbhf!47!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 28 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ REG. CHECK 1 5,962.00 5,962.00CR 0.00 5,962.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-003700 REACH MEDIA NETWORK I 88761 MEDIA PLAYER APBNK 10/12/2023 R 8/07/2023 269.00 269.00CR G/L ACCOUNT CK: 153637 269.00 650 45130-01-404.00 CONTRACTED MACH & EQUIP R & M 269.00 MEDIA PLAYER REG. CHECK 1 269.00 269.00CR 0.00 269.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-005420 REAL ESTATE PUBLISHING CORP I 10766 BRONZE SPONSORSHIP APBNK 10/12/2023 R 7/19/2023 2,500.00 2,500.00CR G/L ACCOUNT CK: 153638 2,500.00 201 46300-01-349.00 OTHER ADVERTISING 2,500.00 BRONZE SPONSORSHIP REG. CHECK 1 2,500.00 2,500.00CR 0.00 2,500.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-005383 REINDERS INC I 3095982-00 IRRIGATION SENSOR DECODER APBNK 10/12/2023 R 8/02/2023 671.99 671.99CR G/L ACCOUNT CK: 153639 671.99 101 45202-01-221.00 EQUIPMENT PARTS 671.99 IRRIGATION SENSOR DECODER I 3096379-01 IRRIGATION PARTS APBNK 10/12/2023 R 7/10/2023 100.14 100.14CR G/L ACCOUNT CK: 153639 100.14 101 45202-01-221.00 EQUIPMENT PARTS 100.14 IRRIGATION PARTS I 3097639-00 IRRIGATION PARTS APBNK 10/12/2023 R 7/27/2023 689.91 689.91CR G/L ACCOUNT CK: 153639 689.91 101 45202-01-221.00 EQUIPMENT PARTS 689.91 IRRIGATION PARTS REG. CHECK 1 1,462.04 1,462.04CR 0.00 1,462.04 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-180675 RENT 'N' SAVE I 75220 AUGUST REST ROOM RENTALS APBNK 10/12/2023 R 8/31/2023 6,250.00 6,250.00CR G/L ACCOUNT CK: 153640 6,250.00 101 45100-01-415.00 OTHER EQUIPMENT RENTAL 6,250.00 AUGUST REST ROOM RENTALS Qbhf!48!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 29 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ I 75221 SEPTEMBER REST ROOM RENTALS APBNK 10/12/2023 R 9/30/2023 5,583.00 5,583.00CR G/L ACCOUNT CK: 153640 5,583.00 101 45100-01-415.00 OTHER EQUIPMENT RENTAL 5,583.00 SEPTEMBER REST ROOM RENTALS I 75222 FOOD TRUCK FEST RENTALS APBNK 10/12/2023 R 9/18/2023 1,730.00 1,730.00CR G/L ACCOUNT CK: 153640 1,730.00 205 49005-01-439.00 OTHER MISCELLANEOUS CHARGES 1,730.00 FOOD TRUCK FEST RENTALS REG. CHECK 1 13,563.00 13,563.00CR 0.00 13,563.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-005198 ROCK HARD LANDSCAPE SUPPLY I 3108407 MULCH CENTRAL PARK APBNK 10/12/2023 R 7/17/2023 320.00 320.00CR G/L ACCOUNT CK: 153641 320.00 101 43121-01-225.00 LANDSCAPING MATERIALS 320.00 MULCH CENTRAL PARK REG. CHECK 1 320.00 320.00CR 0.00 320.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-181805 ROSEMOUNT SAW & TOOL I 343955 SHARPENING TOOLS APBNK 10/12/2023 R 9/25/2023 73.25 73.25CR G/L ACCOUNT CK: 153642 73.25 101 45202-01-241.00 SMALL TOOLS 73.25 SHARPENING TOOLS REG. CHECK 1 73.25 73.25CR 0.00 73.25 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-005607 ROSS NESBIT AGENCIES INC I 1302064 LMCIT PROP./CAS. AGENT FEE APBNK 10/12/2023 R 9/26/2023 12,000.00 12,000.00CR G/L ACCOUNT CK: 153643 12,000.00 206 49006-01-319.00 OTHER PROFESSIONAL SERVICES 10,145.28 LMCIT PROP./CAS. AGENT FEE 201 46300-01-319.00 OTHER PROFESSIONAL SERVICES 42.48 LMCIT PROP./CAS. AGENT FEE 601 49400-01-319.00 OTHER PROFESSIONAL SERVICES 569.76 LMCIT PROP./CAS. AGENT FEE 602 49450-01-319.00 OTHER PROFESSIONAL SERVICES 790.32 LMCIT PROP./CAS. AGENT FEE 603 49500-01-319.00 OTHER PROFESSIONAL SERVICES 142.32 LMCIT PROP./CAS. AGENT FEE 650 45130-01-319.00 OTHER PROFESSIONAL SERVICES 309.84 LMCIT PROP./CAS. AGENT FEE REG. CHECK 1 12,000.00 12,000.00CR 0.00 12,000.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!49!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 30 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-003068 ROTARY CLUB OF ROSEMOUNT I 1006 1ST QTR ROTARY DUES-MARTIN APBNK 10/12/2023 R 7/10/2023 169.00 169.00CR G/L ACCOUNT CK: 153644 169.00 101 41320-01-433.00 DUES & SUBSCRIPTIONS 169.00 1ST QTR ROTARY DUES-MARTIN I 881 3RD QTR ROTARY DUES-MARTIN APBNK 10/12/2023 R 1/09/2022 169.00 169.00CR G/L ACCOUNT CK: 153644 169.00 101 41320-01-433.00 DUES & SUBSCRIPTIONS 169.00 3RD QTR ROTARY DUES-MARTIN I 894 4TH QTR ROTARY DUES-MARTIN APBNK 10/12/2023 R 4/17/2022 169.00 169.00CR G/L ACCOUNT CK: 153644 169.00 101 41320-01-433.00 DUES & SUBSCRIPTIONS 169.00 4TH QTR ROTARY DUES-MARTIN I 910 1ST QTR ROTARY DUES-MARTIN APBNK 10/12/2023 R 7/29/2022 169.00 169.00CR G/L ACCOUNT CK: 153644 169.00 101 41320-01-433.00 DUES & SUBSCRIPTIONS 169.00 1ST QTR ROTARY DUES-MARTIN I 945 2ND QTR ROTARY DUES-MARTIN APBNK 10/12/2023 R 10/14/2022 169.00 169.00CR G/L ACCOUNT CK: 153644 169.00 101 41320-01-433.00 DUES & SUBSCRIPTIONS 169.00 2ND QTR ROTARY DUES-MARTIN I 965 3RD QTR ROTARY DUES-MARTIN APBNK 10/12/2023 R 1/17/2023 169.00 169.00CR G/L ACCOUNT CK: 153644 169.00 101 41320-01-433.00 DUES & SUBSCRIPTIONS 169.00 3RD QTR ROTARY DUES-MARTIN I 977 4TH QTR ROTARY DUES-MARTIN APBNK 10/12/2023 R 4/24/2023 169.00 169.00CR G/L ACCOUNT CK: 153644 169.00 101 41320-01-433.00 DUES & SUBSCRIPTIONS 169.00 4TH QTR ROTARY DUES-MARTIN REG. CHECK 1 1,183.00 1,183.00CR 0.00 1,183.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-001665 ROUGH CUTT I 2023-0388 MOWING @ 3400 144TH ST W APBNK 10/12/2023 R 9/14/2023 325.00 325.00CR G/L ACCOUNT CK: 153646 325.00 101 41910-01-409.00 OTHER CONTRACTED REPAIR & MAIN 325.00 MOWING @ 3400 144TH ST W REG. CHECK 1 325.00 325.00CR 0.00 325.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!4:!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 31 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-191360 S.M. HENTGES & SONS INC I 2023-0389 RSMT LIFETIME ATHLETIC PROJ APBNK 10/12/2023 R 9/30/2023 225,364.76 225,364.76CR G/L ACCOUNT CK: 153647 225,364.76 476 48000-01-521.00 BUILDING & STRUCTURE PURCHASES 225,364.76 RSMT LIFETIME ATHLETIC PROJ REG. CHECK 1 225,364.76 225,364.76CR 0.00 225,364.76 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-005451 SAFE-FAST INC I INV281582 CALIBRATION OF GAS DETECTOR APBNK 10/12/2023 R 10/06/2023 99.00 99.00CR G/L ACCOUNT CK: 153648 99.00 602 49450-01-240.00 SAFETY EQUIPMENT & PPE 99.00 CALIBRATION OF GAS DETECTOR REG. CHECK 1 99.00 99.00CR 0.00 99.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-190095 SAM'S CLUB I 10105561555 FOAMING SOAP APBNK 10/12/2023 R 10/05/2023 119.84 119.84CR G/L ACCOUNT CK: 153649 119.84 101 41940-01-208.00 MISCELLANEOUS SUPPLIES 119.84 FOAMING SOAP REG. CHECK 1 119.84 119.84CR 0.00 119.84 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-006055 DIANE SEGURA I 2023-0373 PERMIT 5076-DAMAGE DEPOSIT APBNK 10/12/2023 R 9/25/2023 300.00 300.00CR G/L ACCOUNT CK: 153650 300.00 101 22005 REFUNDS PAYABLE - P&R 300.00 PERMIT 5076-DAMAGE DEPOSIT REG. CHECK 1 300.00 300.00CR 0.00 300.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-190580 SENTRY SYSTEMS INC I 788285 FS #2 MONITORING-OCT,NOV,DE APBNK 10/12/2023 R 10/01/2023 82.80 82.80CR G/L ACCOUNT CK: 153651 82.80 101 42210-01-439.00 OTHER MISCELLANEOUS CHARGES 82.80 FS #2 MONITORING-OCT,NOV,DEC REG. CHECK 1 82.80 82.80CR 0.00 82.80 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!51!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 32 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-002878 SHRED RIGHT I 0008670 SHREDDING SERVICES APBNK 10/12/2023 R 9/22/2023 17.73 17.73CR G/L ACCOUNT CK: 153652 17.73 101 41940-01-384.00 REFUSE DISPOSAL 17.73 SHREDDING SERVICES REG. CHECK 1 17.73 17.73CR 0.00 17.73 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-005957 SHRED-N-GO INC I 157252 CLEANUP DAY SHREDDING APBNK 10/12/2023 R 10/07/2023 1,759.00 1,759.00CR G/L ACCOUNT CK: 153653 1,759.00 101 41940-01-384.00 REFUSE DISPOSAL 1,759.00 CLEANUP DAY SHREDDING REG. CHECK 1 1,759.00 1,759.00CR 0.00 1,759.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-003600 SIR LINES-A-LOT I H23-0251-08-002 2023 SOUTH METRO JPA APBNK 10/12/2023 R 8/25/2023 34,819.70 34,819.70CR G/L ACCOUNT CK: 153654 34,819.70 101 43121-01-408.00 CRACKSEAL,SEALC'T,PATCH,STRIP 32,220.70 2023 SOUTH METRO JPA 101 43121-01-402.00 PARKING LOT MAINTENANCE 2,599.00 2023 SOUTH METRO JPA I H23-0616-001 GROUND-IN LONG LINE APBNK 10/12/2023 R 7/25/2023 7,536.90 7,536.90CR G/L ACCOUNT CK: 153654 7,536.90 101 43121-01-408.00 CRACKSEAL,SEALC'T,PATCH,STRIP 7,536.90 GROUND-IN LONG LINE REG. CHECK 1 42,356.60 42,356.60CR 0.00 42,356.60 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-004997 STERICYCLE INC I 8004887604 SEPT SHREDDING SERVICES APBNK 10/12/2023 R 9/30/2023 141.38 141.38CR G/L ACCOUNT CK: 153655 141.38 101 42110-01-203.00 PRINTED FORMS & PAPER 141.38 SEPT SHREDDING SERVICES REG. CHECK 1 141.38 141.38CR 0.00 141.38 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!52!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 33 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-192536 STREICHER'S I I1654215 CLOTH NAME TAGS-COUGHLIN APBNK 10/12/2023 R 9/11/2023 23.98 23.98CR G/L ACCOUNT CK: 153656 23.98 208 49008-01-217.00 CLOTHING ALLOWANCE 23.98 CLOTH NAME TAGS-COUGHLIN I I1655862 ALEX ZABOJ UNIFORM APBNK 10/12/2023 R 9/21/2023 276.00 276.00CR G/L ACCOUNT CK: 153656 276.00 101 42110-35-217.00 CLOTHING ALLOWANCE - POLICE 276.00 ALEX ZABOJ UNIFORM REG. CHECK 1 299.98 299.98CR 0.00 299.98 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-006060 SUMMIT FIRE PROTECTION I 2023-0391 RSMT LIFETIME ATHLETIC PROJ APBNK 10/12/2023 R 9/30/2023 15,746.25 15,746.25CR G/L ACCOUNT CK: 153657 15,746.25 476 48000-01-521.00 BUILDING & STRUCTURE PURCHASES 15,746.25 RSMT LIFETIME ATHLETIC PROJ REG. CHECK 1 15,746.25 15,746.25CR 0.00 15,746.25 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-001609 THOMSON REUTERS-WEST I 849045419 SEPT CLEAR CHARGES APBNK 10/12/2023 R 10/01/2023 212.18 212.18CR G/L ACCOUNT CK: 153658 212.18 101 42110-01-433.00 DUES & SUBSCRIPTIONS 212.18 SEPT CLEAR CHARGES REG. CHECK 1 212.18 212.18CR 0.00 212.18 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-202315 TWIN CITY HARDWARE I PSI2217984 BROKEN LOCK REPAIRED APBNK 10/12/2023 R 9/21/2023 217.50 217.50CR G/L ACCOUNT CK: 153659 217.50 101 41940-01-401.00 CONTRACTED BUILDING REPAIRS 217.50 BROKEN LOCK REPAIRED I PSI2218279 PW LOCKS REPAIR APBNK 10/12/2023 R 9/22/2023 135.00 135.00CR G/L ACCOUNT CK: 153659 135.00 101 41520-01-391.00 P.C. MAINTENANCE 135.00 PW LOCKS REPAIR I PSI2221373 RPR CITY HALL CAGE LOCK APBNK 10/12/2023 R 10/04/2023 465.00 465.00CR G/L ACCOUNT CK: 153659 465.00 101 41940-01-401.00 CONTRACTED BUILDING REPAIRS 465.00 RPR CITY HALL CAGE LOCK Qbhf!53!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 34 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ REG. CHECK 1 817.50 817.50CR 0.00 817.50 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-003048 US BANK EQUIPMENT FINANCE I 512234071 IM C3500 LEASE PAYMENT APBNK 10/12/2023 R 10/01/2023 173.00 173.00CR G/L ACCOUNT CK: 153660 173.00 101 41810-01-580.00 OTHER EQUIPMENT 173.00 IM C3500 LEASE PAYMENT REG. CHECK 1 173.00 173.00CR 0.00 173.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-004677 US ICE RINK ASSOCIATION I 3141 FACILITY MEMBERSHIP APBNK 10/12/2023 R 10/04/2023 275.00 275.00CR G/L ACCOUNT CK: 153661 275.00 650 45130-01-433.00 DUES & SUBSCRIPTIONS 275.00 FACILITY MEMBERSHIP REG. CHECK 1 275.00 275.00CR 0.00 275.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-000847 VALLEY-RICH CO INC I 32568 GATE VALVE REPAIRS APBNK 10/12/2023 R 8/25/2023 8,305.50 8,305.50CR G/L ACCOUNT CK: 153662 8,305.50 601 49400-01-403.00 CONTRACTED R & M-OTHER IMPROV 8,305.50 GATE VALVE REPAIRS REG. CHECK 1 8,305.50 8,305.50CR 0.00 8,305.50 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-220480 VERIZON WIRELESS I 9945152162 CELLULAR SERVICE 09/23/2023 APBNK 10/12/2023 R 9/23/2023 2,875.16 2,875.16CR G/L ACCOUNT CK: 153663 2,875.16 101 41110-01-321.00 TELEPHONE COSTS 41.41 CELLULAR SERVICE 09/23/2023 101 41320-01-321.00 TELEPHONE COSTS 114.94 CELLULAR SERVICE 09/23/2023 101 41910-01-329.00 OTHER COMMUNICATION COSTS 365.69 CELLULAR SERVICE 09/23/2023 101 41940-01-321.00 TELEPHONE COSTS 91.10 CELLULAR SERVICE 09/23/2023 101 43121-01-321.00 TELEPHONE COSTS 198.32 CELLULAR SERVICE 09/23/2023 101 45100-01-321.00 TELEPHONE COSTS 502.00 CELLULAR SERVICE 09/23/2023 101 45100-30-321.00 TELEPHONE COSTS 41.41 CELLULAR SERVICE 09/23/2023 101 45202-01-321.00 TELEPHONE COSTS 469.84 CELLULAR SERVICE 09/23/2023 601 49400-01-321.00 TELEPHONE COSTS 254.56 CELLULAR SERVICE 09/23/2023 Qbhf!54!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 35 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 602 49450-01-321.00 TELEPHONE COSTS 254.56 CELLULAR SERVICE 09/23/2023 603 49500-01-321.00 TELEPHONE COSTS 407.10 CELLULAR SERVICE 09/23/2023 101 41520-01-321.00 TELEPHONE COSTS 46.41 CELLULAR SERVICE 09/23/2023 101 43100-01-321.00 TELEPHONE COSTS 87.82 CELLULAR SERVICE 09/23/2023 I 9945152163 BACK UP DIALER SCADA APBNK 10/12/2023 R 9/23/2023 54.17 54.17CR G/L ACCOUNT CK: 153663 54.17 601 49400-01-321.00 TELEPHONE COSTS 18.06 BACK UP DIALER SCADA 603 49500-01-321.00 TELEPHONE COSTS 18.06 BACK UP DIALER SCADA 602 49450-01-321.00 TELEPHONE COSTS 18.05 BACK UP DIALER SCADA REG. CHECK 1 2,929.33 2,929.33CR 0.00 2,929.33 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-002340 VONBANK LAWN CARE I 26343 OCTOBER LAWN SERVICES APBNK 10/12/2023 R 10/08/2023 1,700.00 1,700.00CR G/L ACCOUNT CK: 153665 1,700.00 101 45202-01-409.00 OTHER CONTRACTED REPAIR & MAIN 1,700.00 OCTOBER LAWN SERVICES REG. CHECK 1 1,700.00 1,700.00CR 0.00 1,700.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-003324 WENZEL PLUMBING I 36309 RPZ / BACKFLOW TESTING APBNK 10/12/2023 R 9/27/2023 6,120.00 6,120.00CR G/L ACCOUNT CK: 153666 6,120.00 101 45202-01-403.00 CONTRACTED R & M-OTHER IMPROV 6,120.00 RPZ / BACKFLOW TESTING REG. CHECK 1 6,120.00 6,120.00CR 0.00 6,120.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-006050 WHEELCO TRUCK & TRAILER I INV410304 DIFFERENTIAL FOR PLOW TRUCK APBNK 10/12/2023 R 9/20/2023 7,619.12 7,619.12CR G/L ACCOUNT CK: 153667 7,619.12 101 43100-01-221.00 EQUIPMENT PARTS 7,619.12 DIFFERENTIAL FOR PLOW TRUCK REG. CHECK 1 7,619.12 7,619.12CR 0.00 7,619.12 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!55!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 36 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 01-231910 WSB AND ASSOCIATES INC I 10738-000-7 SWAMP SUBSCRIPTION APBNK 10/12/2023 R 9/26/2023 3,000.00 3,000.00CR G/L ACCOUNT CK: 153668 3,000.00 603 49500-01-405.00 MS4 PERMIT COMPLIANCE 3,000.00 SWAMP SUBSCRIPTION I 11658-000-52 DUNMORE 2ND ADDITION APBNK 10/12/2023 R 9/30/2023 80.00 80.00CR G/L ACCOUNT CK: 153668 80.00 403 48000-01-303.00 ENGINEERING FEES 80.00 DUNMORE 2ND ADDITION I 11659-000-44 HARMONY VILLAS 2ND ADDITION APBNK 10/12/2023 R 9/30/2023 400.00 400.00CR G/L ACCOUNT CK: 153668 400.00 442 48000-01-303.00 ENGINEERING FEES 400.00 HARMONY VILLAS 2ND ADDITION I 13547-000-41 CARAMORE CROSSINGS 1, 2 & 3 APBNK 10/12/2023 R 9/30/2023 1,812.75 1,812.75CR G/L ACCOUNT CK: 153668 1,812.75 454 48000-01-303.00 ENGINEERING FEES 604.25 CARAMORE CROSSINGS 1, 2 & 3 464 48000-01-303.00 ENGINEERING FEES 604.25 CARAMORE CROSSINGS 1, 2 & 3 404 48000-01-303.00 ENGINEERING FEES 604.25 CARAMORE CROSSINGS 1, 2 & 3 I 14675-000-39 BELLA VISTA 7TH ADDITION APBNK 10/12/2023 R 9/30/2023 80.00 80.00CR G/L ACCOUNT CK: 153668 80.00 426 48000-01-303.00 ENGINEERING FEES 80.00 BELLA VISTA 7TH ADDITION I 16720-000-20 DOOLIN HEIGHTS APBNK 10/12/2023 R 9/30/2023 400.00 400.00CR G/L ACCOUNT CK: 153668 400.00 422 48000-01-303.00 ENGINEERING FEES 400.00 DOOLIN HEIGHTS I 16789-000-30 EMERALD ISLE APBNK 10/12/2023 R 9/30/2023 146.25 146.25CR G/L ACCOUNT CK: 153668 146.25 402 48000-01-303.00 ENGINEERING FEES 146.25 EMERALD ISLE I 16934-000-30 ARDAN PLACE APBNK 10/12/2023 R 9/30/2023 113.00 113.00CR G/L ACCOUNT CK: 153668 113.00 460 48000-01-303.00 ENGINEERING FEES 113.00 ARDAN PLACE I 17499-000-28 EMERALD ISLE 2ND ADDITION APBNK 10/12/2023 R 9/30/2023 690.75 690.75CR G/L ACCOUNT CK: 153668 690.75 461 48000-01-303.00 ENGINEERING FEES 690.75 EMERALD ISLE 2ND ADDITION I 17500-000-29 MEADOW RIDGE 4TH ADDITION APBNK 10/12/2023 R 9/30/2023 607.00 607.00CR G/L ACCOUNT CK: 153668 607.00 430 48000-01-303.00 ENGINEERING FEES 607.00 MEADOW RIDGE 4TH ADDITION I 17748-000-27 AMBER FIELDS APBNK 10/12/2023 R 9/30/2023 292.50 292.50CR G/L ACCOUNT CK: 153668 292.50 467 48000-01-303.00 ENGINEERING FEES 292.50 AMBER FIELDS Qbhf!56!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 37 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ I 17930-000-26 DUNMORE 3RD ADDITION APBNK 10/12/2023 R 9/30/2023 560.00 560.00CR G/L ACCOUNT CK: 153668 560.00 463 48000-01-303.00 ENGINEERING FEES 560.00 DUNMORE 3RD ADDITION I 18074-000-22 CONNEMARA TR-EMERALD ISLE E APBNK 10/12/2023 R 9/30/2023 146.25 146.25CR G/L ACCOUNT CK: 153668 146.25 462 48000-01-303.00 ENGINEERING FEES 146.25 CONNEMARA TR-EMERALD ISLE EXT I 18351-000-24 BOULDER AVE EXTENSION APBNK 10/12/2023 R 9/30/2023 2,194.50 2,194.50CR G/L ACCOUNT CK: 153668 2,194.50 469 48000-01-303.00 ENGINEERING FEES 2,194.50 BOULDER AVE EXTENSION I 18668-000-16 OMNI BREWING APBNK 10/12/2023 R 9/30/2023 113.00 113.00CR G/L ACCOUNT CK: 153668 113.00 407 48000-01-303.00 ENGINEERING FEES 113.00 OMNI BREWING I 19220-000-18 RICH VALLEY 1ST ADDITION APBNK 10/12/2023 R 9/30/2023 621.50 621.50CR G/L ACCOUNT CK: 153668 621.50 471 48000-01-303.00 ENGINEERING FEES 621.50 RICH VALLEY 1ST ADDITION I 19324-000-16 TALAMORE 2ND ADDITION APBNK 10/12/2023 R 9/30/2023 788.25 788.25CR G/L ACCOUNT CK: 153668 788.25 472 48000-01-303.00 ENGINEERING FEES 788.25 TALAMORE 2ND ADDITION I 19687-000-16 CENTRAL PARK MASTER PLAN APBNK 10/12/2023 R 9/30/2023 1,272.50 1,272.50CR G/L ACCOUNT CK: 153668 1,272.50 205 49005-01-530.00 IMPROVEMENTS OTHER THAN BLDGS 1,272.50 CENTRAL PARK MASTER PLAN I 19708-000-17 EMERALD ISLE 3RD ADDITION APBNK 10/12/2023 R 9/30/2023 634.25 634.25CR G/L ACCOUNT CK: 153668 634.25 433 48000-01-303.00 ENGINEERING FEES 634.25 EMERALD ISLE 3RD ADDITION I 19979-000-6 ROSEWOOD CROSSING 2ND ADDIT APBNK 10/12/2023 R 9/30/2023 655.75 655.75CR G/L ACCOUNT CK: 153668 655.75 465 48000-01-303.00 ENGINEERING FEES 655.75 ROSEWOOD CROSSING 2ND ADDITION I 20079-000-17 AMBER FIELDS 2ND ADDITION APBNK 10/12/2023 R 9/30/2023 877.50 877.50CR G/L ACCOUNT CK: 153668 877.50 439 48000-01-303.00 ENGINEERING FEES 877.50 AMBER FIELDS 2ND ADDITION I 20403-000-14 AMBER FIELDS 3RD ADDITION APBNK 10/12/2023 R 9/30/2023 508.50 508.50CR G/L ACCOUNT CK: 153668 508.50 408 48000-01-303.00 ENGINEERING FEES 508.50 AMBER FIELDS 3RD ADDITION I 20570-000-16 AMBER FIELDS 4TH ADDITION APBNK 10/12/2023 R 9/30/2023 924.50 924.50CR G/L ACCOUNT CK: 153668 924.50 425 48000-01-303.00 ENGINEERING FEES 585.50 AMBER FIELDS 4TH ADDITION Qbhf!57!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 38 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ 488 48000-01-303.00 ENGINEERING FEES 339.00 AMBER FIELDS 4TH ADDITION I 20605-000-14 AMBER FIELDS 5TH ADDITION APBNK 10/12/2023 R 9/30/2023 1,265.25 1,265.25CR G/L ACCOUNT CK: 153668 1,265.25 441 48000-01-303.00 ENGINEERING FEES 926.25 AMBER FIELDS 5TH ADDITION 425 48000-01-303.00 ENGINEERING FEES 56.50 AMBER FIELDS 5TH ADDITION 489 48000-01-303.00 ENGINEERING FEES 282.50 AMBER FIELDS 5TH ADDITION I 20681-000-12 FRANA PRODUCTION FACILITY APBNK 10/12/2023 R 9/30/2023 480.00 480.00CR G/L ACCOUNT CK: 153668 480.00 477 48000-01-303.00 ENGINEERING FEES 480.00 FRANA PRODUCTION FACILITY I 20822-000-10 LIFETIME CLUB DEVELOPMENT APBNK 10/12/2023 R 9/30/2023 5,215.25 5,215.25CR G/L ACCOUNT CK: 153668 5,215.25 476 48000-01-303.00 ENGINEERING FEES 5,215.25 LIFETIME CLUB DEVELOPMENT I 20847-000-12 ECHELON AT AMBER FIELDS APBNK 10/12/2023 R 9/30/2023 3,145.75 3,145.75CR G/L ACCOUNT CK: 153668 3,145.75 475 48000-01-303.00 ENGINEERING FEES 3,145.75 ECHELON AT AMBER FIELDS I 21037-000-7 AUTUMN TERRACE APBNK 10/12/2023 R 9/30/2023 292.50 292.50CR G/L ACCOUNT CK: 153668 292.50 485 48000-01-303.00 ENGINEERING FEES 292.50 AUTUMN TERRACE I 21280-000-9 SCHAFER RICHARDSON APARTMEN APBNK 10/12/2023 R 9/30/2023 633.25 633.25CR G/L ACCOUNT CK: 153668 633.25 481 48000-01-303.00 ENGINEERING FEES 633.25 SCHAFER RICHARDSON APARTMENTS I 21290-000-12 ROERS CO - ROSEMOUNT APTS APBNK 10/12/2023 R 9/30/2023 2,287.25 2,287.25CR G/L ACCOUNT CK: 153668 2,287.25 480 48000-01-303.00 ENGINEERING FEES 2,287.25 ROERS CO - ROSEMOUNT APTS I 21433-000-4 DRIVER AVENUE ESC APBNK 10/12/2023 R 9/30/2023 508.50 508.50CR G/L ACCOUNT CK: 153668 508.50 628 48000-01-303.00 ENGINEERING FEES 508.50 DRIVER AVENUE ESC I 21700-000-8 2023 GENERAL STORMWATER APBNK 10/12/2023 R 9/30/2023 470.50 470.50CR G/L ACCOUNT CK: 153668 470.50 474 48000-01-303.00 ENGINEERING FEES 287.00 2023 GENERAL STORMWATER 603 49500-01-303.00 ENGINEERING FEES 183.50 2023 GENERAL STORMWATER I 21893-000-5 ROSEWOOD COMMONS 2ND ADDITI APBNK 10/12/2023 R 9/30/2023 877.50 877.50CR G/L ACCOUNT CK: 153668 877.50 490 48000-01-303.00 ENGINEERING FEES 877.50 ROSEWOOD COMMONS 2ND ADDITION I 21997-000-8 2023 STREET IMPV PROJECT APBNK 10/12/2023 R 9/30/2023 46,004.50 46,004.50CR G/L ACCOUNT CK: 153668 46,004.50 486 48000-01-303.00 ENGINEERING FEES 46,004.50 2023 STREET IMPV PROJECT Qbhf!58!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 39 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ I 22008-000-7 ERICKSON MASTER PLAN APBNK 10/12/2023 R 9/30/2023 91.50 91.50CR G/L ACCOUNT CK: 153668 91.50 205 49005-01-530.00 IMPROVEMENTS OTHER THAN BLDGS 91.50 ERICKSON MASTER PLAN I 22322-000-7 CHANNEL AUAR REVIEW APBNK 10/12/2023 R 9/30/2023 216.00 216.00CR G/L ACCOUNT CK: 153668 216.00 101 41910-01-319.00 OTHER PROFESIONAL SERVICES 216.00 CHANNEL AUAR REVIEW I 2235-150-54 SKB EXPANSION PLAN REVIEW APBNK 10/12/2023 R 9/30/2023 80.00 80.00CR G/L ACCOUNT CK: 153668 80.00 478 48000-01-303.00 ENGINEERING FEES 80.00 SKB EXPANSION PLAN REVIEW I 2235-300-65 BELLA VISTA 5TH ADDITION APBNK 10/12/2023 R 9/30/2023 80.00 80.00CR G/L ACCOUNT CK: 153668 80.00 435 48000-01-303.00 ENGINEERING FEES 80.00 BELLA VISTA 5TH ADDITION I 22437-000-5 TALAMORE PARK SURVEY APBNK 10/12/2023 R 9/30/2023 906.00 906.00CR G/L ACCOUNT CK: 153668 906.00 205 49005-01-535.00 IMPROVEMENTS OTHER THAN BLDGS 906.00 TALAMORE PARK SURVEY I 22560-000-5 FHR SOLAR SITE ESC APBNK 10/12/2023 R 9/30/2023 1,655.50 1,655.50CR G/L ACCOUNT CK: 153668 1,655.50 603 49500-01-303.00 ENGINEERING FEES 1,655.50 FHR SOLAR SITE ESC I 22713-000-5 BROCKWAY POND OUTLET IMPV APBNK 10/12/2023 R 9/30/2023 692.00 692.00CR G/L ACCOUNT CK: 153668 692.00 603 49500-01-303.00 ENGINEERING FEES 692.00 BROCKWAY POND OUTLET IMPV I 22714-000-4 2023 MS4 & MONITORING APBNK 10/12/2023 R 9/30/2023 1,908.50 1,908.50CR G/L ACCOUNT CK: 153668 1,908.50 603 49500-01-405.00 MS4 PERMIT COMPLIANCE 1,908.50 2023 MS4 & MONITORING I 22825-000-4 2023 MSA TRAFFIC COUNTS APBNK 10/12/2023 R 9/30/2023 173.00 173.00CR G/L ACCOUNT CK: 153668 173.00 101 43121-01-303.00 ENGINEERING FEES 173.00 2023 MSA TRAFFIC COUNTS I 22911-000-4 AKRON-CONNEMARA TRAFFIC STU APBNK 10/12/2023 R 9/30/2023 7,758.00 7,758.00CR G/L ACCOUNT CK: 153668 7,758.00 101 43121-01-303.00 ENGINEERING FEES 7,758.00 AKRON-CONNEMARA TRAFFIC STUDY I 23065-000-3 PW-PD CAMPUS SITE APBNK 10/12/2023 R 9/30/2023 3,721.25 3,721.25CR G/L ACCOUNT CK: 153668 3,721.25 421 48000-01-303.00 ENGINEERING FEES 3,721.25 PW-PD CAMPUS SITE I 23270-000-2 TALAMORE PARK FINAL DESIGN APBNK 10/12/2023 R 9/30/2023 6,270.75 6,270.75CR G/L ACCOUNT CK: 153668 6,270.75 205 49005-01-535.00 IMPROVEMENTS OTHER THAN BLDGS 6,270.75 TALAMORE PARK FINAL DESIGN Qbhf!59!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 40 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ I 23278-000-2 ARDAN PLACE 2ND ADDITION ES APBNK 10/12/2023 R 9/30/2023 651.50 651.50CR G/L ACCOUNT CK: 153668 651.50 473 48000-01-303.00 ENGINEERING FEES 495.25 ARDAN PLACE 2ND ADDITION ESC 460 48000-01-303.00 ENGINEERING FEES 156.25 ARDAN PLACE 2ND ADDITION ESC I 23409-000-1 2023 BRIDGE SAFETY INSPECTI APBNK 10/12/2023 R 9/30/2023 1,583.50 1,583.50CR G/L ACCOUNT CK: 153668 1,583.50 101 43121-01-303.00 ENGINEERING FEES 1,583.50 2023 BRIDGE SAFETY INSPECTIONS I 23450-000-1 FH ACCESS TRAIL DESIGN APBNK 10/12/2023 R 9/30/2023 1,750.75 1,750.75CR G/L ACCOUNT CK: 153668 1,750.75 205 49005-01-537.00 IMPROVEMENTS OTHER THAN BLDGS 1,750.75 FH ACCESS TRAIL DESIGN I 23542-000-1 AMBER FIELDS 13TH ADDITION APBNK 10/12/2023 R 9/30/2023 866.50 866.50CR G/L ACCOUNT CK: 153668 866.50 496 48000-01-303.00 ENGINEERING FEES 866.50 AMBER FIELDS 13TH ADDITION I 23574-000-1 2023 DATAFI SUBSCRIPTION APBNK 10/12/2023 R 9/30/2023 2,500.00 2,500.00CR G/L ACCOUNT CK: 153668 2,500.00 101 43121-01-394.00 P.C. SOFTWARE PURCHASES 500.00 2023 DATAFI SUBSCRIPTION 101 45202-01-394.00 P.C. SOFTWARE PURCHASES 500.00 2023 DATAFI SUBSCRIPTION 601 49400-01-394.00 P.C. SOFTWARE PURCHASES 500.00 2023 DATAFI SUBSCRIPTION 602 49450-01-394.00 P.C. SOFTWARE PURCHASES 500.00 2023 DATAFI SUBSCRIPTION 603 49500-01-394.00 P.C. SOFTWARE PURCHASES 500.00 2023 DATAFI SUBSCRIPTION I 23763-000-1 AMBER FIELDS 11TH ADDITION APBNK 10/12/2023 R 9/30/2023 444.75 444.75CR G/L ACCOUNT CK: 153668 444.75 494 48000-01-303.00 ENGINEERING FEES 444.75 AMBER FIELDS 11TH ADDITION I 23764-000-1 AMBER FIELDS 12TH ADDITION APBNK 10/12/2023 R 9/30/2023 1,037.50 1,037.50CR G/L ACCOUNT CK: 153668 1,037.50 495 48000-01-303.00 ENGINEERING FEES 1,037.50 AMBER FIELDS 12TH ADDITION REG. CHECK 1 110,486.00 110,486.00CR 0.00 110,486.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-240010 XCEL ENERGY I 0010071743-0 9/23 FH REC COMPLEX IRRIGATION APBNK 10/12/2023 R 9/22/2023 1,036.24 1,036.24CR G/L ACCOUNT CK: 153674 1,036.24 101 45202-01-381.00 ELECTRIC UTILITIES 1,036.24 FH REC COMPLEX IRRIGATION I 0010575696-0 9/23 ERICKSON PARK TENNIS COURTS APBNK 10/12/2023 R 9/22/2023 768.32 768.32CR G/L ACCOUNT CK: 153674 768.32 101 45202-01-381.00 ELECTRIC UTILITIES 768.32 ERICKSON PARK TENNIS COURTS I 0011108910-3 9/23 RSMT SC-ACTIVITY CENTER APBNK 10/12/2023 R 9/22/2023 2,020.29 2,020.29CR G/L ACCOUNT CK: 153674 2,020.29 101 45100-30-381.00 ELECTRIC UTILITIES 2,020.29 RSMT SC-ACTIVITY CENTER Qbhf!5:!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 41 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 VENDOR SEQUENCE VENDOR ITEM NO# DESCRIPTION BANK CHECK STAT DUE DT GROSS PAYMENT OUTSTANDING DISC DT BALANCE DISCOUNT ------------------------------------------------------------------------------------------------------------------------------------ I 0013089608-6 9/23 WELCOME SIGN - SOUTH APBNK 10/12/2023 R 9/22/2023 15.24 15.24CR G/L ACCOUNT CK: 153674 15.24 608 49508-01-381.00 ELECTRIC UTILITIES 15.24 WELCOME SIGN - SOUTH I 0013530257-8 9/23 FLASHING PEDESTRIAN LIGHT APBNK 10/12/2023 R 9/22/2023 13.23 13.23CR G/L ACCOUNT CK: 153674 13.23 608 49508-01-381.00 ELECTRIC UTILITIES 13.23 FLASHING PEDESTRIAN LIGHT I 0014429306-4 9/23 POLICE & PUBLIC WORKS BUILD APBNK 10/12/2023 R 9/28/2023 34.27 34.27CR G/L ACCOUNT CK: 153674 34.27 421 48000-01-381.00 ELECTRIC UTILITIES 34.27 POLICE & PUBLIC WORKS BUILDING I 0519839-2 9/23 UMORE LIGHTS & IRRIGATION APBNK 10/12/2023 R 9/22/2023 652.09 652.09CR G/L ACCOUNT CK: 153674 652.09 101 45202-01-381.00 ELECTRIC UTILITIES 652.09 UMORE LIGHTS & IRRIGATION I 8053588-8 9/23 SIGNAL & STREET LIGHTS APBNK 10/12/2023 R 9/22/2023 130.98 130.98CR G/L ACCOUNT CK: 153674 130.98 101 43121-01-381.00 ELECTRIC UTILITIES 58.47 SIGNAL & STREET LIGHTS 608 49508-01-381.00 ELECTRIC UTILITIES 72.51 SIGNAL & STREET LIGHTS REG. CHECK 1 4,670.66 4,670.66CR 0.00 4,670.66 0.00 ------------------------------------------------------------------------------------------------------------------------------------ 01-003480 YALE MECHANICAL LLC I 247245 SUMMER HVAC MAINT-FS #2 APBNK 10/12/2023 R 10/06/2023 462.00 462.00CR G/L ACCOUNT CK: 153675 462.00 101 41940-01-319.00 OTHER PROFESSIONAL SERVICES 462.00 SUMMER HVAC MAINT-FS #2 REG. CHECK 1 462.00 462.00CR 0.00 462.00 0.00 ------------------------------------------------------------------------------------------------------------------------------------ Qbhf!61!pg!311 10-12-2023 8:51 AM A/P PAYMENT REGISTER PAGE: 42 PACKET: 06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 =================================================== R E P O R T T O T A L S =================================================== F U N D D I S T R I B U T I O N FUND NO# FUND NAME AMOUNT ---------------------------------------------------------- 101 GENERAL FUND 1,094,315.03CR 201 PORT AUTHORITY FUND 2,549.42CR 202 BUILDING CIP FUND 338.00CR 203 STREET CIP FUND 7,537.50CR 205 PARK IMPROVEMENT FUND 14,403.13CR 206 INSURANCE FUND 10,145.28CR 207 EQUIPMENT CIP FUND 29,342.39CR 208 DUI FORFEITURE FUND 23.98CR 242 TIF DOWNTOWN-BROCKWAY 132.50CR 402 EMERALD ISLE 146.25CR 403 DUNMORE 2ND ADDITION 80.00CR 404 CARAMORE CROSSING 3RD 604.25CR 407 OMNI BREWING 113.00CR 408 AMBER FIELDS 3RD ADDITION 508.50CR 421 PD & PW BUILDINGS PROJECT 5,305.52CR 422 DOOLIN HEIGHTS 400.00CR 425 AMBER FIELDS 4TH ADDITION 642.00CR 426 BELLA VISTA 7TH ADDITION 80.00CR 430 MEADOW RIDGE 4TH ADDITION 607.00CR 433 EMERALD ISLE 3RD ADDITION 634.25CR 435 BELLA VISTA 5TH ADDITION 80.00CR 439 AMBER FIELDS 2 OUTLOT G 877.50CR 441 AMBER FIELDS 5TH ADDITION 926.25CR 442 HARMONY VILLAS 2ND ADD'N 400.00CR 446 BONAIRE PATH 161.00CR 454 CARAMORE CROSSING 961.25CR 460 ARDAN PLACE 269.25CR 461 EMERALD ISLE 2ND ADD'N 690.75CR 462 CONNEMARA TR-EMERALD EXT 146.25CR 463 DUNMORE 3RD ADDITION 560.00CR 464 CARAMORE CROSSING 2ND 604.25CR 465 ROSEWOOD CROSSING 2ND 655.75CR 467 AMBER FIELDS 292.50CR 469 BOUDLER AVENUE EXTENSION 2,194.50CR 471 RICH VALLEY 1ST ADDITION 621.50CR 472 BESTER PROPERTY 788.25CR 473 ARDAN PLACE 2ND ADDITION 495.25CR 474 PROJECT BIGFOOT 287.00CR 475 AMBER FIELDS 7TH 3,145.75CR 476 LIFE TIME CLUB 2,550,113.76CR 477 FRANA PRODUCTION FACILITY 480.00CR 478 SKB EXPANSION 80.00CR 480 ROERS APARTMENTS 2,287.25CR 481 SCHAFER RICHARDSON APART 633.25CR 483 AKRON AVE SOUTH EXT 13,598.60CR 485 AUTUMN TERRACE 292.50CR Qbhf!62!pg!311 10-12-2023 8:51 AMA/P PAYMENT REGISTERPAGE: 43 PACKET:06810 10/12/2023 AP CHECK RUN VENDOR SET: 01 =================================================== R E P O R T T O T A L S =================================================== F U N D D I S T R I B U T I O N FUND NO# FUND NAME AMOUNT ---------------------------------------------------------- 486 2023 PAVEMENT MANAGEMENT46,004.50CR 488 AMBER FIELDS 9TH339.00CR 489 AMBER FIELDS 10TH282.50CR 490 ROSEWOOD COMMONS 2ND ADD877.50CR 494 AMBER FIELDS 11TH444.75CR 495 AMBER FIELDS 12TH1,037.50CR 496 AMBER FIELDS 13TH866.50CR 601 WATER UTILITY FUND30,653.76CR 602 SEWER UTILITY FUND155,822.47CR 603 STORM WATER UTILITY FUND8,984.31CR 608 STREET LIGHT UTILITY FUND441.91CR 628 DRIVER AVE & TRK SWR EXT508.50CR 650 ARENA FUND3,383.36CR ** TOTALS ** 3,999,196.92CR ==================================================================================================================================== ---- TYPE OF CHECK TOTALS ---- GROSSPAYMENTOUTSTANDING NUMBERBALANCEDISCOUNT HAND CHECKS0.000.000.00 0.000.00 DRAFTS21,600.001,600.00CR0.00 1,600.000.00 REG-CHECKS131 3,997,596.92 3,997,596.92CR0.00 3,997,596.920.00 EFT0.000.000.00 0.000.00 NON-CHECKS0.000.000.00 0.000.00 ALL CHECKS 133 3,999,196.92 3,999,196.92CR0.00 3,999,196.920.00 ------------------------------------------------------------------------------------------------------------------------------------ ERRORS:0WARNINGS:0 Qbhf!63!pg!311 ROSEMOUNT CITY COUNCIL REGULAR MEETING PROCEEDINGS OCTOBER 3, 2023 CALL TO ORDER/PLEDGE OF ALLEGIANCE Pursuant to due call and notice thereof, a regular meeting of the Rosemount City Council was held on Tuesday, October 3, 2023, at 7:00 PM. in Rosemount Council Chambers, 2875 145th Street West. Mayor Weisensel called the meeting to order with Councilmembers Freske, Essler, Theisen and Klimpel. APPROVAL OF AGENDA Motion by Weisensel Second by Freske Motion to approve agenda Ayes: 5. Nays: None. Motion Carried . PRESENTATIONS, PROCLAMATIONS AND ACKNOWLEDGMENTS None PUBLIC COMMENT Michael Pekarik 13572 Dellwood Way Mr. Pekrik asked several questions regarding the proposed Meta facility and requested any action be postponed until residents approve of the plans. Mr. Pekrik also requested the two ordinance updates on the consent agenda be pulled as he wasn't able to determine the updates made. Linda Nara 15039 Derby Circle Ms. Nara recaptured an article stating there are similarities between the article and the proposed Meta Facility in Rosemount and the future of the area being a 15-minute city questioning how this is being funded and why it is needed in Rosemount. Ms. Nara also stated Rosemount has seen enough change for a while. Jamie Tway 15669 Cornell Trail Ms. Tway voiced concerns regarding the proposed Meta Facility; the history of the land, environmental and health impact, tax burden on residents and concerns about a non- disclosure agreement and concerns about why the public is first hearing about it now. Ms.Tway also questioned why Meta is interested in Rosemount and if there are Federal funds involved Qbhf!64!pg!311 for this project. Al Viall 14235 Azalea Path Mr. Viall voiced concerns regarding the proposed Meta Facility; concerns over the non- disclosure agreement, the environmental impact, impact on the electrical grid, impact on the water system and how Meta will handle toxic waste. Mr. Viall stated that as a candidate for City Council, he cannot support this project. Kathy Pritchard 15703 Crystal Path Ms. Pritchard recapped quotes stating Rosemount is a great place to live, work and do business. Ms. Pritchard has been connected and involved for many years in Rosemount and no longer feels Rosemount is on the right track. Raul Estrata 8302 143rd Street West Apple Valley He expressed concerns regarding the proposed Meta Facility; does Rosemount do their own environmental report, what is the financial gain for the proposed facility and stated Senator Bernie Sanders was in the area recently and questioned if the visit was regarding the facility. He also stated how he works with a lot of communities and discussed the differences between multi-unit housing versus single-family homes and mentioned the number of homeless people and shelters. Angela Zorn 15932 Garden View Drive Apple Valley Ms. Zorn expressed concerns regarding the proposed Meta Facility; specifically the non- disclosure agreement and why the public was left out of the negotiations for the land. Ms. Zorn stated she does not trust Meta and is skeptical about the City approving without the public asking questions. Julie Barner 9836 Alaureate Court Inver Grove Heights Ms. Barner expressed concerns about the plans for UMore Park and the amount of growth it will add to the area. Ms. Barner also questioned the next chapter of development and does not approve of the UMore Property plans. Qbhf!65!pg!311 Michael Pekrik 13572 Dellwood Way Mr. Pekrik expressed concerns about losing the small town feel and requested to put the proposed Meta center on hold in addition to the two proposed ordinance updates on the consent agenda. Robert Hendel 3355 Upper 143rd Street West Mr. Hendel expressed concerns regarding the additional growth and the maintenance of keeping up with the roads and whether residents' taxes would go up. Mr. Hendel also expressed concerns about not receiving public notice of a meeting. Lisa Lyons 16213 Hominy Path Lakeville, MN Ms. Lyons stated she is here to support the others present and request to ahold on the project as there are a lot of concerns regarding the project. Public Comment closed at 7:48 p.m. RESPONSE TO PUBLIC COMMENT Mayor Weisensel provided a statement in response to the September 19th regular meeting: "Thank you for being here today. I want to take some time to address the questions that were raised at, and since, the council meeting last week regarding Project Bigfoot and our work with Jimnist, LLC., the history of its development, and the current issues in play. Because most of the issues brought forward will apply to any business inquiry and development project that comes before the city, I will answer questions through the broad lens of Community Development. First, I’ll talk about the how, then the why, and finally, some questions specific to the land in question. Please be aware that these answers are available in writing, by request. Regarding Why Cities Utilize Code Names in Development: Large companies are often sensitive to news of their location and growth plans getting out ahead of official announcements. Plans often have competitive implications for real estate negotiations, employee retention (if a relocation is being considered), and potential impacts to stock prices if development plans change or are released ahead of schedule.The reality is that businesses typically “shop around” until they are fairly certain that they have found the right spot to develop. Their goal is to minimize the risk and financial investment until they have done their homework. This homework includes working with the City to analyze planning and zoning requirements, public infrastructure such as roads or energy requirements, researching real estate availability, workforce needs, and any potential conflicts, just to name a few. While confidential transactions are common in the site selection and real estate development industry, government is associated with transparency and publicly available information. Because actions taken by city commissions and City Council are open to the public, certain businesses are often hesitant to make applications to the City until they are well-along their own process of site selection and due diligence. So code names and NDAs are quite common in pre-approval Qbhf!66!pg!311 stage. Like many projects our Community Development team works with, it is not about the “who”. We are required to focus on what type of business it is, if and how it integrates into the growth plans of the community, and whether it conforms with City Code. For example, if a hamburger restaurant wants to develop in Rosemount and meets all code and development requirements, they will move through the development process regardless of whether they are White Castle or Smash Burger or Outback Steakhouse. Developing in a smart, safe, and intentional way requires planning.The Comprehensive Plan guides our work and plans for the future, as required by the Metropolitan Council. The Comprehensive Plan does not force any outcome.i. For example….if land is currently zoned agriculture, but guided for business development in the future, the land would not change to business park until the owner applies for that change via a rezoning application. At that point, it is their choice on who they sell to.Rosemount’s Comp Plan offers a Future Land Use Plan that guides development opportunities as they arise. For example…UMore land has been used for agriculture research for many years. When the University’s Board of Regents decided to sell land, our Land Use Plan allows for a change in zoning from Ag to Business Park in order to align with the 2040 Comprehensive Plan. In this case, the University also has a land use plan for their real estate holdings. Per the University: “In 2015, the University's Board of Regents adopted a resolution guiding the future development direction of UMore Park. The University pivoted at that time from the 2008 Concept Master Plan that was quoted at the Council Meeting to a market-based approach to land sales. The future development at UMore Park is guided by the City's Land Use Plan and theAUAR \[a document which studies environmental impacts\].” Why Rosemount? Development is a key goal of the City Council and has been for many years. Development brings jobs, services, and growth to Rosemount.i. These items are highly desired by many of our citizens as we’ve heard through public meetings, citizen surveys, and personal interactions since I’ve been on the city council. Development helps to increase the tax base for our city. This helps to distribute the tax burden and allows us to offer more services. For example: University of Minnesota has owned the UMore land for decades. Because it is a public university, they do not pay taxes on the land. The new land use designation of Business Park will prompt any new ownership to pay taxes on the land – bringing in more funding for amenities and services while decreasing the cost of services for residents. Rosemount is highly desirable to businesses because we have the last remaining parcels of land available in the Twin Cities metro. We have proximity to main highways, the airport, the river, etc. Finally, we were able to work with the University to answer some project specific questions regarding land and cultural implications of this project. Regarding Environmental Concerns at the UMore Site. Per the University: “The University has completed a Remedial Investigation of the UMore Park Property under the supervision of the Minnesota Pollution Control Agency. As part of the Remedial Investigation, the University held public meetings in Rosemount to share the results. The complete reports can be found on the University's website.”“As a result of these investigations, the University does not believe there are any environmental issues with the 280 acres and expects that Jimnist has completed its Qbhf!67!pg!311 own environmental investigation of the property as well.” Regarding Water usage at the proposed site:Every business has varying needs for water usage. Similar to our previous explanation on land use, our development practices guide us to make decisions and requirements based on current and future infrastructure needs throughout the entire city. As Rosemount develops to the East, we are constantly assessing the infrastructure demands that fit into our city planning. Regardless of WHO makes an inquiry, our planning process will be guided by the WHAT of a request. Specifically, does the proposed project work within the boundaries of what our current or planned infrastructure can handle. We expect this project to utilize water resources in the same range as other light- industrial properties we currently have in Rosemount and within the parameters forecasted for the City’s forecasted and permitted water use. Regarding Cultural Concerns at the UMore Site: Per the University: “This broader area of Dakota County is situated on the traditional homelands of the Dakota. This 280-acre parcel has been used for agricultural purposes for decades. The Alternative Urban Areawide Review (AUAR) determined there were no historic or archeological sites on this 280-acre parcel.” We appreciate everyone who has come forward with questions and concerns. Hopefully this response helps to clarify that we are driven by clear guidelines and process that keep us focused on the WHAT and not the WHO in business development. By abiding this framework as we work with business and landowners, we are supporting a free market economy, land use rights, and continued investment in a strong and successful future for Rosemount." The comments at tonight's public comment period will be discussed at the next regular meeting. CONSENT AGENDA Mayor Weisensel acknowledged the request for items 6.c. and 6.f. to be removed and noted for item 6.c. the updates are related to compliance and the regulations will impact any developer coming forward. Motion by Council Member Theisen Second by Council Member Essler Motion to approve consent agenda with items 6.c, 6.f. and 6.h. removed Ayes: 5. Nays: None. Motion Carried. a.Bill Listings b.Minutes of the September 19, 2023 Regular Meeting Minutes c.Amendments to City Code, Title 10: Water Resources Mayor Weisensel further explained the code update; noting the updates are to come into compliance with the Minnesota Municipal Separate Storm Sewer System and Construction Stormwater National Pollutant Discharge Elimination System. Qbhf!68!pg!311 Motion by Council Member Essler Second by Council Member Theisen Motion to Motion to adopt resolution approving summary publication of amendments to Title 10 of City Code and Motion to approve Rosemount amendments to Title 10 of City Code. Ayes: 5. Nays: None. Motion Carried. d.Declaration of Surplus Property e.Resolution for Counting Write-In Voters for Local Elective Office f.Amendments to City Code, Title 3: Business Regulations Mayor Weisensel further explained the code update, noting the updates are not to be more restrictive than state statute for establishments with a liquor license wanting to include a patio area. Motion by Council Member Theisen Second by Council Member Klimpel 1.Motion to Adopt an Ordinance Amending City Code Title 3 Chapter 1 Relating to Liquor Regulations 2.Motion to approve a Resolution Approving Summary Publication of Ordinance 2023- 04 Relating to Liquor Regulations Ayes: 5. Nays: None. Motion Carried. g.Appointing Deputy City Clerks for Election Purpose h.Appointment of Election Judges for 2023 Election Councilmember Klimpel abstained from voting as she is a candidate on the November 7th ballot. Motion by Council Member Theisen Second by Council Member Essler Motion to Motion to approve the attached Resolution appointing election judges and officials for the 2023 Election. Ayes: 4. Nays: None. Motion approved . i.Accept Public Street and Utilities - Emerald Isle 3rd Addition j.Donation Acceptance from Xcel Energy PUBLIC HEARINGS None UNFINISHED BUSINESS None NEW BUSINESS None Qbhf!69!pg!311 ANNOUNCEMENTS a.City Staff Updates Chief of Police Dahlstrom highlighted the kickoff of the annual Pink Patch Project. b.Upcoming Community Calendar Mayor Weisensel reviewed the calendar of events and upcoming meetings. ADJOURNMENT Mayor Weisensel allowed the following resident to speak briefly: Sharon Peterson 13721 Danbury Path Ms. Peterson encouraged the public to come to public meetings and engage. Ms. Peterson also recommended more notice for agendas and public notices and to include descriptions that are understood by the general public. Mayor Weisensel stated there is always way to improve on what we are doing. Mayor encouraged residents to review the website and to connect with staff for any specific questions or comments on the agenda. There being no further business to come before the City Council at the regular council meeting and upon a motion by Weisensel and a second by Freske the meeting was adjourned at 8:19 p.m. The City Council will reconvene to their work session at 8:30 p.m. Respectfully submitted, Erin Fasbender City Clerk Qbhf!6:!pg!311 ROSEMOUNT CITY COUNCIL WORK SESSION PROCEEDINGS OCTOBER 3, 2023 CALL TO ORDER Pursuant to due call and notice thereof, a work session of the Rosemount City Council was held on Tuesday, October 3, 2023, at 5:00 PM. in Rosemount Council Chambers, 2875 145th Street West. Mayor Weisensel called the meeting to order with Councilmembers Essler, Theisen and Klimpel. Councilmember Freske arrived at 5:28 p.m. Planning Commission members present; Kenninger, Herbert, Whitman and Thiagarajan. a.FOLLOWING THE CITY COUNCIL REGULAR MEETING: The Council may choose to reconvene the work session after the adjournment of the regular meeting if the business of the work session is unable to be completed in the allotted time. DISCUSSION a.Zoning Code Update Discussion HKGi presented and discussed the status of the zoning code update project in response to the previous joint work session meeting. The topics discussed this evening were; district standards vs. use specific standards, signage, general development standards, code reorganization and next steps. HKGi highlighted the goal of the code updates are to simplify code language, update zoning districts to reflect the adopted Comprehensive Plan, clean up standards and to comply with state and federal requirements. The updates made from the previous work session include; Low Density Residential Districts updates - Incorporate different setbacks between current R-1 and R-1A districts into new R-1 district, Don’t allow two-unit dwellings in R-1 district and ensure that mixed-use areas are predominately commercial; don’t allow too much residential. In addition, HKGi will include all dimensional standards in tables, making it easier for staff to accurately and quickly respond to questions regarding the standards. The Planning Commissioners and Council were comfortable with making the following updates regarding dynamic signage; decreasing the display time to 30 seconds and to regulate the color to a maximum of 2 colors but the colors must be chosen to where the content is readable. HKGI will include tables for parking requirements again to make it easier for staff to determine the parking requirements for specific uses. HKGi also noted electric vehicle requirements are currently being discussed at the state level and HKGi will monitor any requirements. Staff proposes to recommend electric-vehicle charging stations during the development review process. Qbhf!71!pg!311 The next steps of the code update include completing the full draft and presenting it to the Planning Commission prior to their public hearing, as the entire Planning Commission has not had the opportunity to share their input on the proposed updates. The meeting is likely to take place towards the beginning of 2024. Motion by Mayor Weisensel Second by Council Member Klimpel Motion to recess the work session at 6:37 p.m. to after the regular meeting Ayes: 5. Nays: None. Motion Carried. b.Discuss Police Department Future Needs Mayor Weisensel called the meeting back to order with Councilmembers Freske, Essler, Theisen and Klimpel at 8:40 p.m. Chief Dahlstrom discussed the future needs of the Police Department, highlighting Rosemount in comparison to other cities, the current and projected demands of the Police Department and the increased needs over the years in relation to the state average based on population. The main concerns regarding the current status of the Police Department are the minimums the state recommends for the number of officers per resident, which has not increased since the 90's and, based on the current number of full-time officers, there is a challenge to prevent burn-out, high performance and around the clock supervision in the event someone is out, an emergency occurs involving several officers, etc. Rosemount Police Department has gone from attending 36 events in 2018 to 155 events in 2022.Chief Dahlstrom noted some of the events are contractual services, however several do not including Leprechaun Days. Councilmember Freske recommended Chief Dahlstrom provide an estimated cost of Police Department services during Leprechaun Days and to present that number to the Leprechaun Days Committee. The City Council will have a special work session on October 17th to discuss the future needs of the Fire Department. Following that meeting, the Council would like to further discuss the projections of both departments and have the projections clearly mapped out for the next several years. UPDATES a.Project Updates Staff discussed status of upcoming projects and ribbon cuttings. b.Staff Reports Mayor Weisensel discussed upcoming events. Qbhf!72!pg!311 ADJOURNMENT There being no further business to come before the City Council at the regular council meeting and upon a motion by Weisensel and a second by Essler the meeting was adjourned at 10:11 p.m. Respectfully submitted, Erin Fasbender City Clerk Qbhf!73!pg!311 EXECUTIVE SUMMARY City Council Regular Meeting: October 17, 2023 AGENDA ITEM: Donation Acceptance from American Legion Post AGENDA SECTION: No. 65 - Police Department CONSENT AGENDA PREPARED BY: Mikael Dahlstrom, Police Chief AGENDA NO. 6.d. ATTACHMENTS: Resolution APPROVED BY: LJM RECOMMENDED ACTION: Motion to approve the acceptance and expenditure of $2,000 from American Legion Post No. 65 to be used for Pink Patch Project. BACKGROUND The Police Department received a donation from American Legion Post No. 65 for $2,000. Specifically, the donation will be used for the Pink Patch Project to help purchase winter hats, which is the newest item in the Department's Pink Patch initiative. It is important to note that donations help maximize the annual contribution to the American Cancer Society, so we greatly appreciate their support. RECOMMENDATION Staff recommends that the City Council approve the resolution as attached. Qbhf!74!pg!311 CITY OF ROSEMOUNT DAKOTA COUNTY, MINNESOTA RESOLUTION 2023 - XX A RESOLUTION ACCEPTING A DONATION TO THE CITY WHEREAS, the City of Rosemount is generally authorized to accept donations of real and personal property pursuant to Minnesota Statutes Section 465.03 et seq. for the benefit of its citizens and is specifically authorized to accept gifts; WHEREAS, the following persons and entities have offered to contribute the cash amounts set forth below to the city: Name of DonorAmount American Legion No. 65$2,000 WHEREAS, the terms or conditions of the donations, if any, are as follows: To be used for the Pink Patch Project. WHEREAS, all such donations have been contributed to the city for the benefit of its citizens, as allowed by law; and WHEREAS, the City Council finds that it is appropriate to accept the donations offered. THEREFORE, NOW BE IT RESOLVED by the City Council of the City of Rosemount as follows: 1. The donations described above are accepted and shall be used to establish and/or operate services either alone or in cooperation with others, as allowed by law. 2. The city clerk is hereby directed to issue receipts to each donor acknowledging the city’s receipt of the donor’s donation. th ADOPTED this 17 day of October, 2023, by the City Council of the City of Rosemount. ______________________________ Jeffery D. Weisensel, Mayor ATTEST: _____________________________________ Erin Fasbender, City Clerk Qbhf!75!pg!311 EXECUTIVE SUMMARY City Council Regular Meeting: October 17, 2023 AGENDA ITEM: Donation Acceptance from American Legion Post AGENDA SECTION: No. 65 - Fire Department CONSENT AGENDA PREPARED BY: Richard Schroeder, Fire Chief AGENDA NO. 6.e. ATTACHMENTS: Resolution APPROVED BY: LJM RECOMMENDED ACTION: Motion to approve the acceptance and expenditure of $1,000 from American Legion Post No. 65 to be used for the Fire Department Open House BACKGROUND The Fire Department received a donation from American Legion Post No. 65 for $1,000. The donation will be used for the Fire Department Open House. RECOMMENDATION Staff is recommending that the City Council approve the resolution as attached. Qbhf!76!pg!311 CITY OF ROSEMOUNT DAKOTA COUNTY, MINNESOTA RESOLUTION 2023 - XX A RESOLUTION ACCEPTING A DONATION TO THE CITY WHEREAS, the City of Rosemount is generally authorized to accept donations of real and personal property pursuant to Minnesota Statutes Section 465.03 et seq. for the benefit of its citizens and is specifically authorized to accept gifts; WHEREAS, the following persons and entities have offered to contribute the cash amounts set forth below to the city: Name of DonorAmount American Legion No. 65$1,000 WHEREAS, the terms or conditions of the donations, if any, are as follows: To be used for the Fire Department Open House. WHEREAS, all such donations have been contributed to the city for the benefit of its citizens, as allowed by law; and WHEREAS, the City Council finds that it is appropriate to accept the donations offered. THEREFORE, NOW BE IT RESOLVED by the City Council of the City of Rosemount as follows: 1. The donations described above are accepted and shall be used to establish and/or operate services either alone or in cooperation with others, as allowed by law. 2. The city clerk is hereby directed to issue receipts to each donor acknowledging the city’s receipt of the donor’s donation. th ADOPTED this 17 day of October, 2023, by the City Council of the City of Rosemount. ______________________________ Jeffery D. Weisensel, Mayor ATTEST: _____________________________________ Erin Fasbender, City Clerk Qbhf!77!pg!311 EXECUTIVE SUMMARY City Council Regular Meeting: October 17, 2023 AGENDA ITEM: Hiring New Firefighters AGENDA SECTION: CONSENT AGENDA PREPARED BY: Richard Schroeder, Fire Chief AGENDA NO. 6.f. ATTACHMENTS: APPROVED BY: LJM RECOMMENDED ACTION: Staff recommends the City Council authorize the hiring of additional fire fighters as presented. BACKGROUND Over the past few months, firefighter applicants Jessica Bohlken, Brent Harms, Michael Lee, Will McDonald, and Alex Salinas have gone through physical agility testing, completed a written test, participated in an interview process, completed medical testing and completed background packets that were investigated by the Rosemount Police Department. All listed candidates have successfully passed each phase of the hiring process. RECOMMENDATION Staff recommends approval to hire the above firefighter applicants. Qbhf!78!pg!311 EXECUTIVE SUMMARY City Council Regular Meeting: October 17, 2023 AGENDA ITEM: Engineering Services Contract Amendment for 2023 AGENDA SECTION: Neighborhood Improvement CONSENT AGENDA PREPARED BY: Brian Erickson, City Engineer AGENDA NO. 6.g. ATTACHMENTS: Scope Revisions, Amendment to Supplemental APPROVED BY: LJM Agreement RECOMMENDED ACTION: Motion to Approve an Amendment to the Engineering Services Contract for the 2023 Neighborhood Infrastructure Improvement Project BACKGROUND The 2023 Neighborhood Improvement Project (City Project 2023-04) is currently under construction and a review of the engineering services contract with WSB and Associates, Inc. (WSB) shows the need for an amendment to the contract. This would increase the authorized amount of the contract by $101,899 to a total amount of $277,324, and is sufficient to complete the required engineering services remaining. This amount is equal to 8.2% of the awarded construction contract and within a normally anticipated 10% - 15% cost for engineering. The additional services included as part of this amendment are: 1. Additional design effort in preparing alternate Bacardi cross sections. 2. Making design adjustments based on easements and layout for utilities between Bacardi and 130th Street. 3. Preliminary design work started in 2021 was not as complete as anticipated. 4. Increased involvement with residents during both the design and construction phase. 5. Reviewing complicated easement and right of way issues. This additional cost will not increase the assessments for the residents and is with in the estimated overhead amount for this project. RECOMMENDATION Staff recommends City Council approve an amendment to the engineering services contract for the 2023 Neighborhood Improvement Project, City Project 2023-04 Qbhf!79!pg!311 Pdupcfs!24-!3134 Ns/!Csjbo!Fsjdltpo Ejsfdups!pg!Qvcmjd!Xpslt0Djuz!Fohjoffs Djuz!pg!Sptfnpvou ui 3986!256Tusffu!Xftu Sptfnpvou-!NO!66179 Sf;Amendment toSupplemental Agreementto Provide Professional Engineering Services for 2022Street Improvement Project, City Project 2022-01 Efbs!Ns/!Fsjdltpo; Po!cfibmg!pg!XTC-!boe!gpmmpxjoh!dpowfstbujpot!xjui!Djuz!Tubgg-!xf!bsf!tvcnjuujoh!uijt!qspqptfe! bnfoenfou!up!pvsTvqqmfnfoubm!Bhsffnfou!up!qspwjef!Qspgfttjpobm!Fohjoffsjoh!Tfswjdft!gpsuif! 3133Tusffu!Jnqspwfnfou!Qspkfdu Gpmmpxjoh!bxbse!pg!uif!jojujbm!dpousbdu!up!XTC-!boe!bt!xpsl!po!uif!gfbtjcjmjuz!sfqpsu!cfhbo!po!uif! qspkfdu-!ju!xbt!efufsnjofe!uibu!beejujpobm!eftjho!bmufsobujwfdpotjefsbujpot!xpvme!cf!ofdfttbsz!gps! Cbdbsej!Bwfovf/!Uif!efwfmpqnfou!pg!beejujpobm!eftjho!bmufsobujwft-!wbsjpvt!boe!jufsbujwf!dptu! ftujnbuft!gps!fbdi!pg!uif!bmufsobujwft-!gvoejoh!fwbmvbujpot!boetqfdjbm!bttfttnfou!dbmdvmbujpot! bttpdjbufe!xjui!eftjho!bmufsobujwft!mfe!up!beejujpobm!xpsl!cfzpoe!xibu!xbt!tdpqfe!gps!uif!gfbtjcjmjuz! sfqpsu/!Uijt!beejujpobm!xpsl!upubmfe!$8,087. Xjui!gjobm!eftjho!pg!uif!qspkfdu-!boe!uif!efwfmpqnfou!pg!qmbot!boe!tqfdjgjdbujpot-!uifsf!xfsf! beejujpobm!Cbdbsej!Bwfovf!eftjho!sfwjtjpot!bt!uif!Djuz!xpslfe!xjui!NoEPUTubuf!Bjeup!efwjtf!b! qmbo!uibu!xpvme!nffu!uif!offet!pg!uif!sftjefout!boe!bmtp!tbujtgz!Tubuf!Bje!sfrvjsfnfout-!uif!qspkfdu! xbt!qbsujujpofe!joup!nvmujqmf!qibtft-!dpotusvdujpo!pg!Cbdbsej!Bwfovf!xbt!efmbzfe!up!3134!boe! fbtfnfou!sfwjtjpo!offet!xfsf!ofdfttbsz!bt!uif!Djuz!xpslfe!xjui!qspqfsuz!pxofst/!Uijt!beejujpobm! xpsl!upubmfe!$39,592. dppsejobujpo!xjui!sftjefout!po!uif!qspkfdu-!sfrvjsfe!beejujpobm!boe!tjhojgjdbou!dpotusvdujpo! benjojtusbujpo!boe!dpotusvdujpo!pctfswbujpo!tvqqpsu/!Beejujpobm!dppsejobujpo!xjui!qsjwbuf!vujmjujft-! boe!jodsfbtfe!dpotusvdujpo!tubljoh!offet!up!qspqfsmz!jefoujgz!boe!tublf!fbtfnfout!xjuijo!uif! dpssjeps-!bmtp!dpousjcvufe!up!uijt!sfrvftu!gps!b!tdpqf!bnfoenfou/!Uijt!xpsl!upubmfe!$54,220. XTC!jt!sfrvftujoh!beejujpobm!dpnqfotbujpo!pg!$101,889.00 bttpdjbufe!xjui!uif!tvddfttgvm!efmjwfsz! pg!uif!qspkfdu/Uijt!xpsl!xbt!ofdfttbsz!up!dpnqmfuf!uif!jnqspwfnfout!bt!eftjsfe!gpmmpxjoh!uif! sfwjfx!pg!wbsjpvt!bmufsobujwft!gps!Cbdbsej!Bwfovf!boe!up!qspwjef!jodsfbtfe!dppsejobujpo!xjui! 8-435-!xijdi! sfqsftfout!9/3&!pg!uif!gjobm!dpotusvdujpo!dptut!gps!uif!qspkfdu/!! D;\]Vtfst\]mpdbm`lLptdjfmbl\]JOfuDbdif\]Dpoufou/Pvumppl\]KPK3:ZGM\]132::8.111!Bnfoenfou!up!Tvqqmfnfoubm!Bhsffnfou/epdy Qbhf!81!pg!311 aƩ͵ .ƩźğƓ 9ƩźĭƉƭƚƓ hĭƷƚĬĻƩ ЊЌͲ ЋЉЋЌ tğŭĻ Ћ PROPOSED FEE Xf!bsf!sfrvftujoh!b!dpousbdu!cvehfu!bnfoenfou!pg$101,899.00/Uijt!bnfoenfou!up!pvs! bhsffnfou!xjmm!tfswf!bt!b!tvqqmfnfou!up!uif!Tfqufncfs!7/!3127!Nbtufs!Tfswjdf!Bhsffnfou! cfuxffo!uif!Djuz!pg!Sptfnpvou!boe!XTC/Jg!zpv!bhsff-!qmfbtf!fyfdvuf!cfmpx/ Jg!zpv!ibwf!boz!rvftujpot-!qmfbtf!ep!opu!iftjubuf!up!dpoubdu!nf!bu!:63.848.5786-!ps!Lbujf!Lptdjfmbl bu!723.393.4752/ Tjodfsfmz- XTC Npojdb!Ifjm-!QFLbujf!Lptdjfmbl Wjdf!Qsftjefou!pg!Nvojdjqbm!TfswjdftQspkfdu!Nbobhfs Buubdinfou!Qspkfdu!Cvehfu!Bnfoenfou!Xpsltiffu ACCEPTED BY: CITY OF ROSEMOUNT, MN Signature: Name/Title: Date: Qbhf!82!pg!311 EXECUTIVE SUMMARY City Council Regular Meeting: October 17, 2023 AGENDA ITEM: Land Exchange Agreement AGENDA SECTION: CONSENT AGENDA PREPARED BY: Logan Martin, City Administrator AGENDA NO. 6.h. ATTACHMENTS: Resolution Approving Exchange Agreement, APPROVED BY: LJM Resolution Approving Donation Agreement, Land Exchange Agreement RECOMMENDED ACTION: Motion to approve the City of Rosemount entering into an exchange agreement with the State of Minnesota concerning two parcels of property located in Dakota County and Motion to approve the City of Rosemount entering into a donation agreement with Flint Hills Resources Pine Bend, LLC for the donation to the City of certain property located within the City. BACKGROUND The three-way land swap between Flint Hills Resources, the City of Rosemount, and the National Guard is closing on October 18th. At the request of the title company, action is required by council to approve the attached land exchange agreement and resolutions which include specific language approving the conditions and restrictions related to the deed. The City Council has previously authorized agreements to receive land from Flint Hills and to convey that property to the National Guard. This action is a purely administrative request to finalize the documents needed prior to closing. This language has been reviewed and approved by Kennedy & Graven and must be approved before the transaction can be finalized between Flint Hills, the City, and the National Guard. RECOMMENDATION Staff is recommending that the City Council approve the resolutions as attached. Qbhf!83!pg!311 CITY OF ROSEMOUNT DAKOTA COUNTY, MINNESOTA RESOLUTION NO. 2023-_____ A RESOLUTION APPROVING THE CITY OF ROSEMOUNT TO ENTER INTO AN EXCHANGE AGREEMENT WITH THE STATE OF MINNESOTA CONCERNING TWO PARCELS OF PROPERTY LOCATED IN DAKOTA COUNTY WHEREAS, the City of Rosemount (the “City”) participated in a planning process to acquire property within the City for its police department and public works facility; and WHEREAS, the City has entered into that certain donation agreement with Flint Hills Resources Pine Bend, LLC, a Delaware limited liability company, dated May 30, 2023 (the “Donation Agreement”), whereby FHR will be donating certain real property located within the City consisting of approximately 20 acres (PID No. 34-01500-75- 014), legally described on the attached Exhibit A (the “FHR Property”); and WHEREAS, the Donation Agreement restricts the City’s ability to convey the FHR Property, except to the State of Minnesota, Department of Military Affairs (the “State”) for purposes of building an armory upon the FHR Property; WHEREAS, the State desires to split certain property it owns within the City, to create an approximately 20 acre parcel legally described on the attached Exhibit B (the “State Property”); and WHEREAS, the State desires to obtain the FHR Property for the purpose of building an armory, and the City desires to obtain the State Property for the purpose of constructing the police department and public works facility; and WHEREAS, the City and the State desire to enter into an Exchange Agreement, under which, among other things, the City will convey the FHR Property to the State and the State will convey the State Property to the City. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Rosemount, Minnesota as follows: 1.The recitals set forth herein are incorporated into and made a part hereof. 2.The proposed exchange of the FHR Property for the State Property is hereby approved. 3.Erin Fasbender, City Clerk, and Jeffery D. Weisensel, Mayor, are hereby authorized and directed to execute all appropriate documents, including but not limited to an DOCSOPEN\\RS220\\429\\907756.v2-10/10/23 Qbhf!84!pg!311 Exchange Agreement, to effectuate the conveyance of the FHR Property and the acceptance of the State Property. 4.The City Clerk and Mayor, staff, and consultants are hereby authorized and directed to take all additional steps and actions necessary or convenient in order to accomplish the intent hereof. th ADOPTED this 17 of October 2023. ____________________________________ Jeffery D. Weisensel, Mayor ATTEST: ________________________________ Erin Fasbender, City Clerk DOCSOPEN\\RS220\\429\\907756.v2-10/10/23 Qbhf!85!pg!311 EXHIBIT A Legal Description of FHR Property \[to be inserted\] DOCSOPEN\\RS220\\429\\907756.v2-10/10/23 Qbhf!86!pg!311 EXHIBIT B Legal Description of State Property \[to be inserted\] DOCSOPEN\\RS220\\429\\907756.v2-10/10/23 Qbhf!87!pg!311 CITY OF ROSEMOUNT DAKOTA COUNTY, MINNESOTA RESOLUTION NO. 2023-_____ A RESOLUTION APPROVING THE CITY OF ROSEMOUNT TO ENTER INTO A DONATION AGREEMENT WITH FLINT HILLS RESOURCES PINE BEND, LLC, FOR THE DONATION TO THE CITY OF CERTAIN PROPERTY LOCATED WITHIN THE CITY WHEREAS, the City of Rosemount (the “City”) participated in a planning process to acquire property within the City for its police department and public works facility (the “Project”); and WHEREAS, the City desires to acquire certain property within the City related to the Project, and entered into that certain donation agreement with Flint Hills Resources Pine Bend, LLC, a Delaware limited liability company, dated May 30, 2023, as amended by Amendment to Donation Agreement dated September 27, 2023 (collectively, the “Donation Agreement”), whereby FHR will be donating to the City certain real property consisting of approximately 20 acres (PID No. 34-01500-75-014) legally described on the attached Exhibit A (the “FHR Property”); and WHEREAS, the Donation Agreement restricts the City’s ability to convey the FHR Property, except to the State of Minnesota, Department of Military Affairs for purposes of building an armory upon the FHR Property, and imposes certain other conditions upon the City’s use of the FHR Property; WHEREAS, the City desires to accept the FHR Property and the conditions and restrictions as contained in the Donation Agreement and any amendments thereto. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Rosemount, Minnesota as follows: 1.The recitals set forth herein are incorporated into and made a part hereof. 2.The proposed donation of the FHR Property to the City is hereby approved. 3.Erin Fasbender, City Clerk, and Jeffery D. Weisensel, Mayor, are hereby authorized and directed to execute all appropriate documents to effectuate the donation of the FHR Property to the City. 4.The City Clerk and Mayor, staff, and consultants are hereby authorized and directed to take all additional steps and actions necessary or convenient in order to accomplish the intent hereof. DOCSOPEN\\RS220\\429\\907761.v2-10/10/23 Qbhf!88!pg!311 th ADOPTED this 17of October 2023. ____________________________________ Jeffery D. Weisensel, Mayor ATTEST: ________________________________ Erin Fasbender, City Clerk DOCSOPEN\\RS220\\429\\907761.v2-10/10/23 Qbhf!89!pg!311 EXHIBIT A Legal Description of FHR Property \[to be inserted\] DOCSOPEN\\RS220\\429\\907761.v2-10/10/23 Qbhf!8:!pg!311 LAND EXCHANGE AGREEMENT This Land Exchange Agreement ( Agreement) is made this ____ day of _____________, “” 2023, by and between the City of Rosemount, a Minnesota municipal corporation (the City) and “” the State of Minnesota, Department of Military Affairs, a political subdivision of the State of Minnesota (the “State ”). Each may be referred to as a “Party ” or collectively, the “Parties ” under this Agreement. RECITALS WHEREAS, the City has entered into a donation agreement dated May 30, 2023, as amended by a first amendment to the donation agreement, with Flint Hills Resources Pine Bend, LLC, a Delaware limited liability company (“Flint Hills ”), for the donation by Flint Hills to the City of approximately 20 acres of real property located in the City of Rosemount (PID No. 34- 01500-75-014) legally described on the attached Exhibit A (the “City Property ”). For purposes of this Agreement, the donation agreement and the first amendment thereto are collectively referred to as the “Donation Agreement and WHEREAS, the State owns certain property located at 14221 Biscayne Avenue, Rosemount, Minnesota (PID No. 34-03700-00-030) (the “Existing Parcel ”). As more particularly set forth in this Agreement, prior to the Closing Date the State will subdivide from the Existing Parcel approximately 20 acres of property as legally described on Exhibit B and depicted on Exhibit C (collectively, the “State Property ”); and WHEREAS, the City wishes to convey the City Property to the State; and WHEREAS, the State wishes to convey the State Property to the City. AGREEMENT 1.OFFER/ACCEPTANCE. In consideration of the mutual agreements herein contained, the City offers and agrees to convey the City Property to the State and the State offers and agrees to convey the State Property to the City. The City and the State accept the parcels so offered. 2.VALUE FOR STATE DEED TAX PURPOSES. For purposes of determining values for State Deed Tax, the Parties agree that the value of the City Property is $480,700.00 and the value of the State Property is $1,392,240.00. 3.DEED/MARKETABLE TITLE: Subject to performance by the State, the City agrees to execute and deliver a limited warranty deed conveying marketable title to the City Property to the State, subject only to the following exceptions: A.Building and zoning laws, ordinances, state, and federal regulations. B.All easements, restrictions, and reservations of record. 1 DOCSOPEN\\RS220\\429\\904905.v1-9/26/23 Qbhf!91!pg!311 C.Restrictive covenants contained in the form of special warranty deed from Flint Hills to the City for the City Property as contained on Exhibit D. Subject to performance by the City, the State agrees to execute and deliver a limited warranty deed conveying marketable title to the State Property to the City, subject only to the following exceptions: A.Building and zoning laws, ordinances, state, and federal regulations. B.Reservation of minerals or mineral rights to the State of Minnesota, if any. C.All easements, restrictions, and reservations of record. 4.CONTINGENCIES . This Agreement is subject to: a) the approval of the City’s governing body; b) the closing of the transaction between Flint Hills and the City for the conveyance of the City Property to the City as described in the Donation Agreement; and c) the subdivision of the State Property from the Existing Parcel pursuant to paragraph 8, below. If the contingencies described in a) or c) of this paragraph are not satisfied prior to Closing this Agreement may be voided at the written option of the City. As a contingent conveyance, the termination of this Agreement is not required pursuant to Minnesota Statutes Section 559.21, et seq. The contingency described in b) of this paragraph shall be deemed satisfied upon the City closing with Flint Hills on the City Property, without further action of the City. 5.DOCUMENTS TO BE DELIVERED BY THE CITY AT CLOSING. In addition to the limited warranty deed required by paragraph 3 above, the City shall deliver to the State: A.Standard form Affidavit of Seller. B.A certificate in a form acceptable to the City and the State, signed by an authorized representative of the City, certifying that the representations and warranties contained in this Agreement are true in all material respects as of the Closing Date (the City’s “Bring-Down Certificate”). C.Affidavit of the City confirming that the City is not a foreign person within the meaning of Section 1445 of the Internal Revenue Code. D.Well disclosure certificate or a statement that the City is not aware of any wells on the Property. E.Such other documents as may be reasonably required by the title insurance company. 6.DOCUMENTS TO BE DELIVERED BY THE STATE AT CLOSING. In addition to the limited warranty deed required by paragraph 3 above, the State shall deliver to the City: A. Standard form Affidavit of Seller. B.A certificate in a form acceptable to the City and the State, signed by an authorized 2 DOCSOPEN\\RS220\\429\\904905.v1-9/26/23 Qbhf!92!pg!311 representative of the State, certifying that the representations and warranties contained in this Agreement are true in all material respects as of the Closing Date (the State’s “Bring-Down Certificate”). C.Affidavit of the State confirming that the State is not a foreign person within the meaning of Section 1445 of the Internal Revenue Code. D.Well disclosure certificate or a statement that the State is not aware of any wells on the Property. E.Such other documents as may be reasonably required by the title insurance company. 7.MARKETABILITY OF TITLE. Within a reasonable time after approval and execution of this Agreement by both Parties, the City shall order a commitment for title insurance for both the City Property and the State Property, at the City’s expense. The title commitment for the City Property shall name the State as the proposed insured. The title commitment for the State Property shall name the City as the proposed insured. Each Party shall have 7 business days after receipt of its title commitment to examine the same and to deliver written objections to title, if any, to the other Party. Each Party shall have 20 days after receipt of written objections to cure title defects, at the transferor’s cost. Neither Party shall have any obligation to cure any objections. If title to either parcel cannot be made marketable by the transferor by the Closing Date, then, at the option of the transferee, this Agreement shall be null and void and neither Party shall be liable for damages or costs to the other Party. 8.ENVIRONMENTAL MATTERS. The City and its agents have the right to enter upon the City Property for the purpose of inspecting the City Property and conducting such environmental examination and tests pursuant and subject to the terms of the Donation Agreement. The City agrees to coordinate such environmental testing of the City Property with the State, subject to the terms of the Donation Agreement prior to the Closing Date. Any such tests of the City Property requested by the State shall be conducted at the State’s expense. The City and its agents shall have the right to enter upon the State Property for the purpose of inspecting the State Property and conducting at all reasonable times such environmental examination and tests it deems necessary, at the City’s expense. The City agrees to indemnify the State, to the extent such indemnification is legally authorized, against any liens, claims, losses, or damage occasioned by the City’s exercise of its right to enter and inspect the State Property. Each Party agrees to provide the other Party with a copy of any report as a result of such examination and tests. If such environmental examination results in a finding that there are or may be pollutants or contaminants on the City Property or the State Property, either Party may terminate this Agreement at any time prior to the Closing Date. 9.SUBDIVISION APPROVAL. Prior to the Closing Date, the State shall, at its sole cost and expense, subdivide the State Property as a single tract from the Existing Parcel in conformance with the depiction of the State Property set forth on Exhibit C. The City shall reasonably cooperate with the State’s applications for, and other matters related to the subdivision including, without limitation, executing any documents or other agreements reasonably necessary to process and effectuate the subdivision of the State Property from the Existing Parcel. The legal description 3 DOCSOPEN\\RS220\\429\\904905.v1-9/26/23 Qbhf!93!pg!311 and depiction of the State Property resulting from the subdivision shall automatically replace the description and depiction of the State Property set forth on Exhibit B and Exhibit C, respectively, attached to this Agreement, and any such updated legal description shall thereafter be used as the legal description of the State Property for purposes of conveying the State Property from the State to the City at the Closing. 10.CLOSING DATE . The closing of the exchange of the properties (“Closing shall take place on October 18, 2023, or such other date agreed upon by the Parties (the “Closing Date ”). The closing shall take place at the offices of First American Title Insurance Company, located at 121 South 8th Street, Suite 1250, Minneapolis, Minnesota, or such other location as mutually agreed upon by the Parties. 11.CLOSING COSTS AND RELATED ITEMS. The City will be responsible for: A.The cost of the title commitments and any associated title search and examination fees for both the City Property and the State Property, and the cost for any premium for title insurance of the City Property and the State Property; and B.Recording fee for the deed to the State Property; and C.State Deed Tax and conservation fee attributable to the State Property; and D.All closing fees charged by the title company to close this transaction; and E.Its own attorneys’ and accounting fees associated with this transaction. The State will be responsible for: A.Recording fee for any documents required to make the deed for the State Property marketable; and B.Recording fee for the deed to the City Property; and C.State Deed Tax and conservation fee attributable to the City Property; D.The cost to subdivide the Existing Parcel in order to create the State Property in accordance with paragraph 9 of this Agreement. E.Its own attorneys’ and accounting fees associated with this transaction. 12.REAL ESTATE TAXES AND SPECIAL ASSESSMENTS. The State shall pay, at or before closing all real estate taxes due and payable in all years prior to the year of closing, if any. Real estate taxes due and payable in the year of closing, if any, shall be pro-rated between the City and the State based on the Closing Date. The State shall pay on the Closing Date all special assessments levied or pending as of the Closing Date, if any. The payment of all real estate taxes and special assessments on the City Property as of the Closing Date has been allocated between Flint Hills 4 DOCSOPEN\\RS220\\429\\904905.v1-9/26/23 Qbhf!94!pg!311 and the City pursuant to the Donation Agreement. 13.POSSESSION/CONDITION OF PROPERTY. A.Possession. The Parties agree to deliver possession of their respective parcels on the Closing Date. B.Condition of Property/No Personal Property. Each Party shall deliver possession of its respective parcel to the other Party on the Closing Date in the same condition as the parcel existed on the date of this Agreement. Each Party acknowledges that the parcels are vacant land and there are no items of personal property included in this exchange. C. AS IS, WHERE IS. Each Party acknowledges that it has inspected or will have “” had the opportunity to inspect the parcel that will be conveyed to it pursuant to this transaction and agrees to accept that parcel “AS IS.” Such conveyance shall be without representation of warranties, express or implied, either oral or written, made by the Party or any official, employee or agent of the Party with respect to the physical condition of the parcel, including but not limited to, the existence or absence of petroleum, hazardous substances, pollutants or contaminants in, on, or under, or affecting the parcel or with respect to the compliance of the parcel or its operation with any laws, ordinances, or regulations of any government or other body, except as stated above. Each Party acknowledges and agrees that the other Party has not made and does not make any representations, warranties, or covenants of any kind or character whatsoever, whether expressed or implied, with respect to warranty of income potential, operating expenses, uses, habitability, tenant ability, or suitability for any purpose, merchantability, or fitness of the parcel for a particular purpose, all of which warranties the Party hereby expressly disclaims, except as stated above. Each Party is relying entirely upon information and knowledge obtained from its own investigation, experience and knowledge obtained from its own investigation, experience, or personal inspection of the parcel. Each Party expressly assumes, at closing, all environmental and other liabilities with respect to the parcel and releases and indemnifies the other Party from same, whether such liability is imposed by statute or derived from common law including, but not limited to, liabilities arising under the Comprehensive Environmental Response, Compensation and Liability Act (“CERCLA”), the Hazardous and Solid Waste Amendments Act, the Resource Conservation and Recovery Act (“ RCRA” ), the federal Water Pollution Control Act, the Safe Drinking Water Act, the Toxic Substances Act, the Superfund Amendments and Reauthorization Act, the Toxic Substances Control Act, and the Hazardous Materials Transportation Act, all as amended, and all other comparable federal, state or local environmental conservation or protection laws, rules or regulations. The foregoing assumption and release shall survive Closing. All statements of fact or disclosures, if any, made in this Agreement or in connection with this Agreement, do not constitute warranties or representations of any nature. The foregoing provision shall survive Closing and shall not be deemed merged into any 5 DOCSOPEN\\RS220\\429\\904905.v1-9/26/23 Qbhf!95!pg!311 instrument of conveyance delivered at Closing. 14.DISCLOSURE; INDIVIDUAL SEWAGE TREATMENT SYSTEM. Each Party certifies to the other that to the best of its knowledge it does not know of any individual sewage treatment systems on the parcel it will transfer. 15.WELL DISCLOSURE. Each Party certifies to the other Party that to the best of its knowledge it does not know of any wells on the parcel it will transfer. 16.UNDERGROUND STORAGE TANKS. Each Party certifies to the other Party that to the best of its knowledge it does not know of any underground storage tanks located on the parcel it will transfer. 17.SELLERS WARRANTIES. Each Party warrants that it has the requisite power and ’ authority to enter into this Agreement, and the person signing this Agreement and the closing documents on its behalf are authorized to do so. Each Party warrants that, to the best of its knowledge, there have been no labor or materials furnished to the parcel it will transfer for which payment has not been made. Each Party warrants that it is not a “foreign person” as such term is defined in the Internal Revenue Code. The State warrants that there are no present violations of any restrictions relating to the use or improvement of its respective parcel. These warranties shall survive Closing. 18.RELOCATION BENEFITS. Each Party represents and asserts to the other that the transactions set forth in this Agreement will not cause the Party to be a displaced person within the meaning of Minnesota Statutes, Section 117.50, Subd. 3, and that it is therefore not entitled to any relocation assistance, services, payments or benefits under Minnesota Statutes, Section 117.52. 19.BROKER COMMISSIONS. Each Party represents and warrants to the other that there is no broker involved in this transaction with whom the Party has negotiated or to whom the Party has agreed to pay a broker commission. 20.NO MERGER OF REPRESENTATIONS, WARRANTIES. All representations and warranties contained in this Agreement shall not be merged into any instruments or conveyance delivered at Closing, and the Parties shall be bound accordingly. 21.ENTIRE AGREEMENT; AMENDMENTS. This Agreement executed herewith constitutes the entire agreement between the Parties and no other agreement prior to this Agreement shall be effective except as expressly set forth or incorporated herein. Any purported amendment shall not be effective unless it shall be set forth in writing and executed by both Parties. 22.CONTROLLING LAW. This Agreement shall be governed by the laws of the State of Minnesota. 23.NO PARTNERSHIP OR JOINT VENTURE. Nothing in this Agreement shall be construed or interpreted as creating a partnership or joint venture between the City and the State relative to either parcel that is the subject of the transaction contemplated by this Agreement. 6 DOCSOPEN\\RS220\\429\\904905.v1-9/26/23 Qbhf!96!pg!311 24.BINDING EFFECT; ASSIGNMENT. This Agreement shall be binding upon and inure to the benefit of the Parties and their respective successors and assigns. The Parties shall not assign their rights and interests hereunder. 25.NOTICE. Any notice, demand, request, or other communication which may or shall be given or served by the Parties shall be deemed to have been given or served on the date the same is deposited in the United States Mail, registered, or certified, postage prepaid and addressed as follows: a.If to the City:City of Rosemount Attn: Logan Martin, City Administrator 2875 145th Street West Rosemount, MN 55068 with a copy to:Kennedy & Graven, Chartered Attn: Rosemount City Attorney Fifth Street Towers 150 South Fifth Street, Suite 700 Minneapolis, MN 55402 b.If to the State:State of Minnesota, Department of Military Affairs Attn:__________________ 20 W. 12th St. St. Paul, MN 55155 26.SPECIFIC PERFORMANCE. This Agreement may be specifically enforced by the Parties, provided that any action for specific enforcement is brought within six months after the date of the alleged breach. This paragraph is not intended to create an exclusive remedy for breach of this Agreement; the Parties reserve all other remedies available at law or in equity. 27.COUNTERPARTS. This Agreement may be executed in any number of counterparts, each of which shall constitute one and the same instrument. 28.SEVERABILITY. If any provision of this Agreement is found by a court of competent jurisdiction to be invalid or unenforceable, the remaining provisions of this Agreement shall remain in full force and effect and shall be interpreted, performed, and enforced as if the invalid or unenforceable provision did not appear herein. 29.RECITALS. The Recitals set forth in the preamble to this Agreement and the Exhibits attached to this Agreement are incorporated into this Agreement as if fully set forth herein. \[Signatures on following page.\] 7 DOCSOPEN\\RS220\\429\\904905.v1-9/26/23 Qbhf!97!pg!311 IN WITNESS WHEREOF, the Parties have executed this Agreement as of the above date. CITY OF ROSEMOUNT By:__________________________________ Jeffery D. Weisensel Its:Mayor By: ___________________________________ Erin Fasbender Its:City Clerk STATE OF MINNESOTA, DEPARTMENT OF MILITARY AFFAIRS By: ______________________ Its:____________________________________ 8 DOCSOPEN\\RS220\\429\\904905.v1-9/26/23 Qbhf!98!pg!311 EXHIBIT A LEGAL DESCRIPTION OF THE CITY PROPERTY A tract of land situated in Dakota County, Minnesota, more specifically described as follows: The South Half of the Southwest Quarter of the Southeast Quarter of Section 15, Township 115 North, Range 19 West, Dakota County, Minnesota. Subject to Parcel 21, Dakota County ROW Map No. 486, per Document No. 3323061 SUBJECT TO THE FOLLOWING EXCEPTIONS AND RESERVATIONS: (1.) All easements, restrictions, and reservations of record; (2.) All matters apparent from a visual inspection of said real property. A-1 DOCSOPEN\\RS220\\429\\904905.v1-9/26/23 Qbhf!99!pg!311 EXHIBIT B LEGAL DESCRIPTION OF THE STATE PROPERTY That part of Lot 3, Auditor’s Subdivision One (1), Rosemount, Dakota County, Minnesota, which lies north of the following described line: Commencing at the northeast corner of the Northeast Quarter of Section 29, Township 115 North, Range 19 West, Dakota County, Minnesota, also being the northeast corner of said Lot 3; thence on an assumed bearing of South 00 degrees 37 minutes 39 seconds West, along the east line of said Northeast Quarter, also being the east line of said Lot 3, a distance of 905.04 feet to the point of beginning of said line to be described; thence South 88 degrees 36 minutes 48 seconds West, a distance of 1110.57 feet, more or less, to the west line of said Lot 3. DOCSOPEN\\RS220\\429\\904905.v1-9/26/23 Qbhf!9:!pg!311 EXHIBIT C DEPICTION OF THE STATE PROPERTY DOCSOPEN\\RS220\\429\\904905.v1-9/26/23 Qbhf!:1!pg!311 EXHIBIT D FORM OF SPECIAL WARRANTY DEED FROM FLINT HILLS TO THE CITY SPECIAL WARRANTY DEED STATE OF MINNESOTA) ) COUNTY OF DAKOTA) Flint Hills Resources Pine Bend, LLC, a Delaware limited liability company, (“Grantor”), with a th place of business at 4111 East 37 Street North, Wichita, Kansas 67220, for good and valuable consideration, the receipt and sufficiency of which is hereby acknowledged, does hereby grant, sell and convey unto the City of Rosemount, Minnesota (“Grantee”), having a place of business at _________________, Rosemount, Minnesota 55033-1955, all of its right title and interest in and to the property and premises which are more particularly described on Exhibit A attached hereto and made a part hereof, together with all and singular the rights and appurtenances belonging in any way to such property (the “Property”), subject to the exceptions and reservations stated or referred to in Exhibit A and for so long as Property Owners (as defined below) abide by the following restrictions: A.The following “Restrictive Covenant(s)” shall be imposed with respect to the Property: To the fullest extent permitted by applicable law, Grantee, on its behalf and on behalf of its successors and assigns and all present and future owners and occupiers of and/or successors in title or interest to the Property and any part thereof (collectively, “Property Owners”), and agrees to the following: (i)To not allow the Property to be used for residential purposes, it being the expressed intent of the parties hereto that the Property will be used for conveyance to the United States National Guard, as previously agreed only and that at no time will any persons be domiciled or otherwise reside on the Property; (ii)To prevent the withdrawal of groundwater on, at, under or from the Property for any private or public use including, but not limited to, recreational, potable, irrigation, commercial, industrial, residential and other possible uses; (iii)Except for the construction, installation, reconstruction, repair, and maintenance of a National Guard Armory, to prevent the digging of any holes and excavations of any soil on, at, under or from the Property; and (iv)Not to sell or otherwise transfer the Property without the prior written consent of Grantor. Grantor hereby grants consent to a sale or transfer of the Property to the United States National Guard. The term “residential purposes” shall include, but not be limited to, use for dwellings such as single-family houses or multi-family dwellings and apartments, children’s homes, elderly housing, nursing homes, residential portions of government-owned lands (local, state or federal), day care facilities, educational facilities, hospitals or other medical care facilities, and churches. The above covenants shall apply to and bind each and every Property Owner, and their respective successors and assigns, and shall operate as a covenant running with the land and passing with title to the Property and any part thereof. B.The Restrictive Covenants set forth herein shall not act to waive, rescind or modify any other restrictions that may be in effect against the Property, it being the intention that the Restrictive Covenants are to supplement and not replace, modify or amend any restrictions or other covenants pertaining to the use of the Property in effect as of the date hereof. Grantee may request in writing a waiver of said Restrictive Covenants but no waiver, rescission, amendment or other modification of thereof shall DOCSOPEN\\RS220\\429\\904905.v1-9/26/23 Qbhf!:2!pg!311 be effective unless made in a writing signed by an office of Grantor. The waiver of or failure to enforce any of the restrictions or covenants contained herein shall in no event be deemed to be a waiver of the right to do so at any time thereafter. C.If at any time Property Owner breaches a Restrictive Covenant, the Property shall immediately revert to Grantor, and Grantor shall have an immediate right to enter and take the Property. GRANTEE ACKNOWLEDGES AND AGREES THAT GRANTOR HAS NOT MADE, DOES NOT MAKE, AND EXPRESSLY DISCLAIMS ANY WARRANTIES, REPRESENTATIONS, COVENANTS, OR GUARANTEES, EITHER EXPRESS OR IMPLIED, WHETHER ARISING BY OPERATION OF LAW OR OTHERWISE, AS TO THE MERCHANTABILITY, QUANTITY, QUALITY, ENVIRONMENTAL CONDITION, OR PHYSICAL CONDITION OF THE PROPERTY OR ITS SUITABILITY OR FITNESS FOR ANY PARTICULAR PURPOSE OR USE. GRANTEE AFFIRMS THAT IT: (I) HAS INVESTIGATED AND INSPECTED THE PROPERTY AND IS FAMILIAR AND SATISFIED WITH ITS ENVIRONMENTAL CONDITION AND PHYSICAL CONDITION AND (II) HAS MADE ITS OWN DETERMINATION AS TO THE (A) MERCHANTABILITY, QUANTITY, QUALITY, ENVIRONMENTAL CONDITION, AND PHYSICAL CONDITION OF THE PROPERTY, INCLUDING THE POSSIBLE PRESENCE ON, AT, UNDER, OR EMANATING FROM THE PROPERTY OF HAZARDOUS MATERIALS OR OTHER ENVIRONMENTAL CONTAMINATION, AND (B) PROPERTY’S SUITABILITY OR FITNESS FOR ANY PARTICULAR PURPOSE OR USE. GRANTEE HEREBY ACCEPTS THE PROPERTY IN ITS PRESENT ENVIRONMENTAL CONDITION AND PHYSICAL CONDITION ON AN “AS IS,” “WHERE IS,” AND “WITH ALL FAULTS AND DEFECTS” (INCLUDING ENVIRONMENTAL) BASIS, REGARDLESS OF HOW SUCH FAULTS AND DEFECTS WERE CAUSED OR CREATED (BY GRANTOR’S NEGLIGENCE, ACTIONS, OMISSIONS, OR FAULT, OR OTHERWISE), AND ACKNOWLEDGES THAT: (A) WITHOUT THIS ACCEPTANCE, THIS SALE WOULD NOT BE MADE, AND (B) GRANTOR SHALL NOT BE UNDER ANY OBLIGATION WHATSOEVER TO UNDERTAKE ANY IMPROVEMENT, REPAIR, MODIFICATION, ALTERATION, REMEMDIATION, OR OTHER WORK OF ANY KIND WITH RESPECT TO ANY OF THE PROPERTY. GRANTOR IS HEREBY EXPRESSLY RELEASED BY GRANTEE AND ITS SUCCESSORS AND ASIGNS FROM ANY AND ALL RESPONSIBILITIES, LIABILITIES, OBLIGATIONS, AND CLAIMS, KNOWN AND UNKNOWN, WHETHER BASED UPON NEGLIGENCE, STRICT LIABILITY OR OTHERWISE, ARISING UNDER ENVIRONMENTAL STATUTES, COMMON LAWS, OR ANY OTHER LEGAL REQUIREMENT, INCLUDING ANY OBLIGATIONS TO TAKE THE PROPERTY BACK AND ANY ACTIONS FOR CONTRIBUTION, INDEMNITY, OR TO IMPROVE, REPAIR OR OTHERWISE MODIFY THE PHYSICAL CONDITION OR OPERATION OF THE PROPERTY, THAT GRANTEE OR ITS SUCCESSORS OR ASSIGNS MAY HAVE AGAINST GRANTOR OR THAT MAY ARISE IN THE FUTURE, BASED, IN WHOLE OR IN PART, UPON THE PRESENCE OF HAZARDOUS MATERIALS OR OTHER ENVIONRMENTAL CONTAMINATION ON, AT, UNDER, OR EMANATING FROM THE PROPERTY OR ARISING FROM THE ENVIRONMENTAL CONDITION OR PHYSICAL CONDITION OF THE PROPERTY, REGARDLESS OF HOW CAUSED OR CREATED (BY GRANTOR’S NEGLIGENCE, ACTIONS, OMISSIONS, OR FAULT, PURSUANT TO ANY STATUTORY SCHEME OR STRICT LIABILITY, OR OTHERWISE). GRANTEE FURTHER ACKNOWLEDGES THAT THE PROVISIONS OF THIS SECTION HAVE BEEN FULLY EXPLAINED TO GRANTEE AND THAT IT FULLY UNDERSTANDS AND ACCEPTS THE SAME AS A CONDITION TO PROCEEDING WITH THIS TRANSACTION. GRANTEE ACKNOWLEDGES THAT NONE OF GRANTOR’S EMPLOYEES, AGENTS, OR REPRESENTATIVES HAS MADE ANY STATEMENTS OR REPRESENTATIONS CONTRARY TO THE PROVISIONS OF THIS SECTION. DOCSOPEN\\RS220\\429\\904905.v1-9/26/23 Qbhf!:3!pg!311 GRANTOR MAKES NO WARRANTY OR REPRESENTATION, EXPRESS, IMPLIED, STATUTORY OR OTHERWISE, AS TO THE ACCURACY OR COMPLETENESS OF ANY TITLE OPINION, DATA, REPORTS, RECORDS, PROJECTIONS, INFORMATION, OR MATERIALS NOW, HERETOFORE, OR HEREAFTER FURNSHIED OR MADE AVAILABLE TO GRANTEE IN CONNECTION WITH THE PROPERTY, INCLUDING ANY DESCRIPTION OF THE PROPERTY, THE PRICING ASSUMPTIONS, THE ENVIRONMENTAL CONDITION, OR PHYSICAL CONDITION OF THE PROPERTY, ANY OTHER MATTERS CONTAINED IN THE DATA, OR ANY OTHER MATERIALS FURNISHED OR MADE AVAILABLE TO GRANTEE BY GRANTOR OR BY GRANTOR’S EMPLOYEES, AGENTS, OR REPRESENTATIVES. GRANTEE HAS RELIED, AND WILL RELY, SOLEY UPON ITS INDEPENDENT INVESTIGATION OF, AND JUDGEMENT WITH RESPECT TO, THE PROPERTY AND ITS VALUE. Check applicable box: ___ Grantor certifies that Grantor does not know of any wells on the described property. ___ A well disclosure certificate accompanies this document. ___ I (the undersigned representative of the Grantor) am familiar with the property described in this instrument and I certify that the status and number of wells on the described real property have not changed since the last previously filed well disclosure certificate. TO HAVE AND TO HOLD said described Property unto the Grantee, Grantee’s successors and assigns forever. Grantor warrants title to the Property, subject to the foregoing exceptions and restrictions, unto Grantee against any and all acts, conveyances, liens and encumbrances affecting such Property made or suffered to be made or done by, through or under Grantor, but not otherwise. IN WITNESS WHEREOF, Grantor has executed this instrument this _____ day of _________________, 2023. FLINT HILLS RESOURCES PINE BEND, LLC (“Grantor”) By: Jeff Ramsey President and Chief Executive Officer STATE OF KANSAS ss.: } COUNTY OF SEDGWICK This instrument was acknowledged before me this _______ day of ______________________, 2023, by Jeff Ramsey, President and Chief Executive Officer of Flint Hills Resources Pine Bend, LLC, a Delaware limited liability company, on behalf of said limited liability company. Notary Public DOCSOPEN\\RS220\\429\\904905.v1-9/26/23 Qbhf!:4!pg!311 Executed this ___________ day of ______________________, 2023 by: CITY OF ROSEMOUNT (“Grantee”) By: Jeffery D. Weisensel, Mayor By: Erin Fasbender, City Clerk STATE OF MINNESOTA ss.: } COUNTY OF DAKOTA The foregoing was acknowledged before me this ______ day of ______________, 2023, by Jeffery D. Weisensel, Mayor of the City of Rosemount, a Minnesota municipal corporation, on behalf of the municipal corporation. ________________________________ NOTARY STAMP SIGNATURE OF PERSON TAKING ACKNOWLEDGMENT STATE OF MINNESOTA ss.: } COUNTY OF DAKOTA The foregoing was acknowledged before me this ______ day of ______________, 2023, by Erin Fasbender, City Clerk of the City of Rosemount, a Minnesota municipal corporation, on behalf of the municipal corporation. SIGNATURE OF PERSON TAKING ACKNOWLEDGMENT NOTARY STAMP Mail Tax Statements to: City of Rosemount Attn: City Administrator th 2875 145 Street West Rosemount, Minnesota 55068-4997 DRAFTED BY: Haley O’Neill, Senior Counsel Flint Hills Resources, LC th 4111 East 37 Street North Wichita, Kansas 67220 DOCSOPEN\\RS220\\429\\904905.v1-9/26/23 Qbhf!:5!pg!311 EXECUTIVE SUMMARY City Council Regular Meeting: October 17, 2023 AGENDA ITEM: Appointment of Additional Election Judges for AGENDA SECTION: November 7, 2023 Election CONSENT AGENDA PREPARED BY: Erin Fasbender, City Clerk AGENDA NO. 6.i. ATTACHMENTS: Resolution APPROVED BY: LJM RECOMMENDED ACTION: Motion to Approve the Attached Resolution Appointing Additional Election Judges for the November 7, 2023 Election BACKGROUND Minn. Stat. 204B.21, Subd. 2, requires that all cities appoint election judges before the election. Minn. Stat. 204B.21 also states additional judges may be appointed within 25 days of the election if it is determined additional election judges will be required. All judges are required to attend online election judge training and equipment training courses. RECOMMENDATION Staff is recommending that the City Council approve the resolution as attached. Qbhf!:6!pg!311 CITY OF ROSEMOUNT DAKOTA COUNTY, MINNESOTA RESOLUTION 2023 - XX RESOLUTION APPOINTING ADDITIONAL ELECTION JUDGES FOR NOVEMBER 7, 2023 ELECTION WHEREAS, Minnesota Statute 204B.21 requires the governing body of a municipality to appoint election judges to serve in its precincts; and WHEREAS, the Rosemount 2023 Election appointments consists of individuals recommended by the City Clerk with the approval of the majority of the City Council. NOW, THEREFORE BE IT RESOLVED, that the general public listed below to serve as election judges reside in in the State of Minnesota as required by Minnesota Election Laws and will be trained according to Minnesota State Statutes: Drinen, Matthew Ellinwood, Jennifer Linkert,Janet B. Pitzen, Molly Rougier-Hill, Michelle Shoe, Lisa Slater, Andrea Warweg, Stephen NOW THEREFORE BE IT FURTHER RESOLVED, that pursuant to Minn. Stat. 204B.21, requires that all cities appoint election judges before the election. th ADOPTED this 17 day of October, 2023 by the City Council of the City of Rosemount. _______________________________________ Jeffery D. Weisensel, Mayor ATTEST: ___________________________________ Erin Fasbender, City Clerk Qbhf!:7!pg!311 EXECUTIVE SUMMARY City Council Regular Meeting: October 17, 2023 AGENDA ITEM: Bella Vista Greenway Trail Project - Change Order AGENDA SECTION: #2 CONSENT AGENDA PREPARED BY: Dan Schultz, Parks & Recreation Director AGENDA NO. 6.j. ATTACHMENTS: Change Order APPROVED BY: LJM RECOMMENDED ACTION: Motion to approve Change Order #2 for the Bella Vista Greenway Trail Project. BACKGROUND In April of 2022, the City Council awarded a bid for the Bella Vista Greenway Trail project. The project is coming to an end, but during recent construction of the project a change has been needed. This has resulted in a project change order being submitted by SRF Inc. Staff is requesting the City Council consider approving change order #2, which is detailed below. The total amount of change order #2 is $4,285.25. The change to the project came as a result of a request by the City to hydro-seed additional areas along the trail. As you may recall, the City entered into a Joint Powers Agreement with Dakota County to have them pay for the construction of the regional trail. The cost of change order #2 will be passed on to the County as part of their funding of the project. City staff plans to close this project out by October 31, 2023. RECOMMENDATION Staff is recommending the City Council approve Change Order #2 for the Bella Vista Greenway Trail Project. Qbhf!:8!pg!311 Qbhf!:9!pg!311 EXECUTIVE SUMMARY City Council Regular Meeting: October 17, 2023 AGENDA ITEM: Declaration of Surplus Property – Parks and AGENDA SECTION: Recreation Department CONSENT AGENDA PREPARED BY: Dan Schultz, Parks & Recreation Director AGENDA NO. 6.k. ATTACHMENTS: APPROVED BY: LJM RECOMMENDED ACTION: Motion to declare the item listed in the executive summary as surplus property and for staff to try to appropriately recycle, sell or dispose of the item. BACKGROUND The Parks and Recreation Department is asking that the City Council declare the disc golf baskets at the Brockway Disc Golf Course as surplus property. The equipment was purchased in 2010 and the City is planning to replace the baskets in 2023 with new equipment. By declaring these items as surplus property, it will authorize staff to appropriately recycle, sell or dispose of the equipment. The item listed below will no longer be used within the City’s operations. Brockway Disc Golf Baskets Fixed Asset Tag # 2005027 RECOMMENDATION Staff recommends the City Council declare the item listed in the executive summary as surplus property and for staff to appropriately recycle, sell or dispose of the item Qbhf!::!pg!311 EXECUTIVE SUMMARY City Council Regular Meeting: October 17, 2023 AGENDA ITEM: Lite Time Facility - Change Order #1 AGENDA SECTION: CONSENT AGENDA PREPARED BY: Dan Schultz, Parks & Recreation Director AGENDA NO. 6.l. ATTACHMENTS: Life Time Facility CO#1 APPROVED BY: LJM RECOMMENDED ACTION: Motion to approve Change Order #1 for the Life Time Facility as listed in the Executive Summary and detailed in the Attached Documents BACKGROUND In May of 2023, the City Council started awarded construction contracts for the Life Time Facility. The project is progressing as expected and we have encountered a few changes that are needed. These changes require that staff submit change order #1 to the City Council for your review and consideration. The proposed changes are listed below and are detailed in the attached documents. Aquatics $3,683.00 Structural $(88,022.00) Concrete $38,217.00 Civil $57,080.68 HVAC & Plumbing $58,761.57 Total $69,720.25 The funds needed for the change orders will come from the project contingency fund which is budgeted at $884,000. RECOMMENDATION Staff is recommending the City Council approve change order #1 for the Life Time Facility as listed in the Executive Summary and detailed in attached documents Qbhf!211!pg!311 Qbhf!212!pg!311 Qbhf!213!pg!311 Qbhf!214!pg!311 Qbhf!215!pg!311 Qbhf!216!pg!311 Qbhf!217!pg!311 Qbhf!218!pg!311 Qbhf!219!pg!311 Qbhf!21:!pg!311 Qbhf!221!pg!311 EXECUTIVE SUMMARY City Council Regular Meeting: October 17, 2023 AGENDA ITEM: Joint Powers Agreement with Dakota County - AGENDA SECTION: Absentee Voting Administration Services in 2024 CONSENT AGENDA and 2025 PREPARED BY: Erin Fasbender, City Clerk AGENDA NO. 6.m. ATTACHMENTS: Joint Powers Agreement APPROVED BY: LJM RECOMMENDED ACTION: Staff recommends approving a Joint Powers Agreement between Dakota County and certain cities, townships, and school districts in Dakota County for the provision of absentee voting administration services in 2024 and 2025 BACKGROUND Absentee voting has become an important part of elections and the demand for absentee ballots continues to grow. Staff play a crucial role in managing various aspects of elections, including processing of absentee ballots. Staffs' general responsibilities related to absentee ballots include; processing absentee ballot applications online, in-person and via mail, issuance of absentee ballots, receiving returned absentee ballots from voters, accepting or rejecting returned ballots by trained election judges serving on Absentee Ballot Boards, securing and storing absentee ballots, processing and counting absentee ballots and reporting absentee ballot results as part of the overall election results. As the demand increases for absentee ballots, it becomes more labor intensive for staff. To ensure elections are administered consistently, fairly, and accurately, cities and school districts in Dakota County have requested Dakota County provide more absentee voting services similar to several other Minnesota counties that provide centralized processing of absentee ballots. The City Council approved an absentee voting administration joint powers agreement for the 2023 Election on July 11, 2023. To date, the services provided by Dakota County have been positive and have been beneficial to the overall administration of the election. During the last session, the Minnesota State Legislature established the Voting Operations, Technology, and Election Resources (VOTER) account. Money in the account is appropriated annually to the Secretary of State for distribution. Dakota County will receive the funds and distribute them to cities. Rosemount is expected to receive $5,016 for 2024 and 2025. The funds may only be used for expenditures directly related to election administration and absentee voting. Rosemount has the option to direct Dakota County to retain the funds and apply them to the services provided under this JPA, which is staff's recommendation. After applying the VOTER funds, Rosemount's portion of the absentee voting administration services performed by Dakota County for 2024-2025 is estimated at $18,115. Dakota County will bill the actual costs following each election. The 2024 proposed budget includes the estimated total for these services. Qbhf!222!pg!311 RECOMMENDATION Staff is recommending that the City Council approve the joint powers agreement as attached. Qbhf!223!pg!311 2024 AB Admin Joint Powers Agreement DCA20889 Dakota County Contract No. DCA20889 JOINT POWERS AGREEMENT BETWEEN DAKOTA COUNTY AND THE CITIES, TOWNSHIPS, AND SCHOOL DISTRICTS IN DAKOTA COUNTY FOR THE PROVISION OF ABSENTEE VOTING ADMINISTRATION SERVICES This is a Joint Powers Agreement (“Agreement”) between the County of Dakota (“County”) and THE CITIES, TOWNSHIPS, AND SCHOOL DISTRICTS IN DAKOTA COUNTY (“Governmental Entities”) (collectively the “Parties”) entered into pursuant to Minn. Stat. §471.59, for the provision of absentee voting administration services. Section 1 Term And Renewal 1.This Agreement shall be in effect beginning January 1, 2024, until December 31, 2025, subject to automatic renewal on January 1 of each even calendar year for a two-year term beginning January 1, 2026. Section 2 Contract Termination 2.This Agreement may be terminated as follows: 2.1. Participation in this Agreement may be terminated without cause by the County or individual Governmental Entity effective at the end of the initial term or renewal term by providing written notice to the Parties no later than June 1 in the year prior (the odd year of the two-year term) to the next automatic renewal in Section 1; 2.2. This Agreement may be terminated by the County effective at the end of a renewal term by providing written notice to the Governmental Entities no later than July 15 in the year prior to the next automatic renewal in Section 1, if the County determines, in its sole discretion, that there is an insufficient number of Governmental Entities in Dakota County participating in this Agreement to share the fixed costs of Absentee Voting Administration between the remaining participating Governmental Entities; 2.3.The County or individual GovernmentalEntities may terminate their participation inthis Agreement for cause by providing at least seven days’ written notice to the County and other Governmental Entities. A party may terminate this agreement for cause due to a material breach of the terms of this Agreement, including failure to provide payment within the time specified in this Agreement. The written notice must state the intent to terminate participation and specify the events or circumstances and relevant provision warranting termination of the Agreement or withdrawal of the individual Governmental Entity and may, in the discretion of the terminating party, contain an opportunity to cure the default. A termination for cause will not be effective for any election that will have an election day within 90 days of the termination date to ensure transition of absentee voting responsibilities; 2.4. Termination of this Agreement does not discharge any liability, responsibility, or right of the Parties that arises from the performance of, or failure to adequately perform the provisions of this Agreement prior to the effective date of termination, such as payment of an invoice for services satisfactorily performed prior to the effective date of termination. Termination of the Agreement or an individual Governmental Entity’s termination of participation does not discharge any obligation which, by its nature, would survive after the date of termination. Page 1 of 6 Qbhf!224!pg!311 Section 3 Absentee Voting Administration 3.County and the Governmental Entities agree to consolidate absentee voting administration countywide in accordance with the Absentee Voting Administration Division of Duties By Joint Powers Agreement attached hereto as Attachment A and incorporated by reference. The Parties agree by executing the Agreement, the County Election Director and the Governmental Entities’ Clerks may agree, in writing, to modify operational responsibilities identified in Attachment A for operational efficiency and to maintain compliance with election laws, rules and regulations. Prior to April 1 of each calendar year, the Parties shall meet to discuss performance of the previous year election cycle and evaluate roles and duties of the Parties. In addition to temporary staffing necessary to administer absentee voting, County will hire at least two full-time equivalent (“FTE”) positions (Elections Systems Manager and Election Coordinator, or successor positions) (“FTE Costs”) to ensure sufficient resources are available to manage the consolidated absentee voting for the County while maintaining service levels of all other election work. In agreeing to the consolidation of absentee voting administrative functions to ensure the successful conduct of multiple, simultaneous elections in the County, the Parties acknowledge that decisions made by the County regarding resources, procedures, and policies are based upon providing the same scope and level of service to all the participating jurisdictions and the Governmental Entities recognize that such decisions, made for the benefit of the whole, may not be subject to review by the Governmental Entities. Section 4 Applicability 4.This Agreement between the County and the Governmental Entities is limited to absentee voting administration. All other voting processes are outside of the scope of this Agreement. This Agreement is applicable for all regularly scheduled elections or special elections in a precinct within the jurisdiction of Dakota County. Section 5 Allocation of Costs and Invoicing 5.The County will invoice each Governmental Entity its cost share allocation for fixed costs and its share of variable costs for its voters that voted via absentee voting. 5.1. The Governmental Entities will proportionately share the County’s absentee balloting administration fixed costs annually based on the annual FTE Cost incurred by the County for this Agreement (“Fixed Costs”). The Fixed Costs allocated to a Governmental Entity is proportionate to its share of registered voters. 5.2. The Governmental Entities agree that absentee balloting administration variable costs, such as absentee voter application and absentee ballot mailings, incurred by the County shall be shared among the Governmental Entities based on actual utilization by its voters (Variable Costs). Page 2 of 6 Qbhf!225!pg!311 5.3. In even-numbered years for regularly scheduled or State special elections, the County shall assume 55% of Fixed Costs and Variable Costs. Each Governmental Entity shall assume the remaining portion of the Fixed Cost share as set forth in 5.1 and 45% of Variable Costs for the actual number of its voters that voted via absentee voting. 5.4. In even-numbered years for a city or township special election not held on a date for an election identified in Section 5.3 each Governmental Entity holding an election shall assume 100% of Variable Costs for the actual number of its voters that voted via absentee voting. 5.5. In odd-numbered years, the County shall assume 75% of Fixed Costs. Each Governmental Entity shall assume the remaining portion of its Fixed Cost share as set forth in 5.1. 5.6.In odd-numbered yearsfor State specialelections, the Countyshall assume 55% of Variable Costs. Each Governmental Entity shall assume the remaining 45% of Variable Costs for the actual number of its voters that voted via absentee voting. 5.7. In odd-numbered years, Governmental Entities holding elections other than State, County, or Federal elections shall assume 100% of Variable Costs for the actual number of its voters that voted via absentee voting. If such an election is layered with a school district election, the Governmental Entity conducting an election shall only be responsible for 50% of the Variable Costs related to a voter eligible to also vote in the school district election. 5.8. Each Governmental Entity will be invoiced within sixty (60) days of the final election day of each calendar year. Said invoice shall be due and payable within thirty-five (35) calendar days of invoicing. Invoicing will occur after application of any grant or other state or federal funds received by the County for absentee voting administration. 5.9. For illustrative purposes, cost projections for the 2024-2025 elections are attached as Attachment B. Final invoices will reflect actual absentee utilization and Variable Costs. Section 6 Electronic Voting System and E-Pollbook Costs 6.The cost of the purchase, operation and maintenance of the electronic voting system, voting machines, and electronic pollbooks are not included in this Agreement and are the subject of separate agreements. Section 7 Independent Contractor 7.It is agreed that nothing in this Agreement is intended or should be construed as creating the relationship of agents, partners, joint ventures, or associates between the Parties hereto or as constituting the County or the Governmental Entities as the employee of the other entity for any purpose or in any manner whatsoever. The County is an independent contractor and neither it, its employees, agents, nor its representatives are employees of Page 3 of 6 Qbhf!226!pg!311 the Governmental Entities. From any amounts due the County, there shall be no deductions for federal income tax or FICA payments, nor for any state income tax, nor for any other purposes which are associated with an employer-employee relationship unless required by law. Section 8 Data Practices 8.All data created, collected, received, maintained, or disseminated for any purpose in the course of this contract is governed by the Minnesota Government Data Practices Act, any other applicable statute, or any rules adopted to implement the Act or statute, as well as federal statutes and regulations on dataprivacy. Election data shall also be governed by Minnesota Election Law and associated Minnesota Rules. Section 9 No Waiver 9.No delay or omission by the Parties to exercise any right or power occurring upon any noncompliance or default with respect to any of the terms of this Agreement shall impair any such right or power or be construed to be a waiver thereof unless the same is consented to in writing. A waiver by the County or the Governmental Entities of any of the covenants, conditions, or agreements to be observed by the Parties shall not be construed to be a waiver of any succeeding breach or of any covenant, condition, or agreement herein contained. All remedies provided for in this Agreement shall be cumulative and in addition to, and not in lieu of, any other remedies available to the Parties at law, in equity, or otherwise. Section 10 Governing Law 10.This Agreement shall be governed by and construed in accordance with the laws of the State of Minnesota. Section 11 Entire Agreement 11.It is understood and agreed that the entire Agreement between the Parties is contained herein and that this Agreement supersedes all oral agreements and negotiations between the Parties relating to the subject matter hereof and hereby rescinds and replace all prior Agreements with the respective Governmental Entities with this Agreement. All items referred to in this Agreement are incorporated or attached and are deemed to be part of this Agreement. Any alterations, variations, modifications, or waivers of provisions of this Agreement shall only be valid when they have been reduced to writing as an amendment to this Agreement signed by the Parties hereto. Section 12 No Assignment 12.The Parties may not assign, sublet, or transfer this Agreement, either in whole or in part, without the prior written consent of the Governmental Entities and the County and any attempt to do so shall be void and have no force and effect. Page 4 of 6 Qbhf!227!pg!311 Section 13 Notice 13.Any notice or demand shall be in writing and shall be sent registered or certified mail to the other party addressed as follows: To the Governmental Entity: To the person and address designated by each Governmental Entity in writing. To the County: Dakota County Elections Director 1590 Highway 55 Hastings MN 55033 Section 14 Audit Provision 14.The Parties agree that the State Auditor, or any of their duly authorized representatives at any time during normal business hours, and as often as they may reasonably deem necessary, shall have access to and the right to examine, audit, excerpt, and transcribe any books, documents, papers, records, etc., which are pertinent to the accounting practices and procedures of the respective Parties and involve transactions relating to this Agreement. Such materials shall be maintained, and such access and rights shall be in force and effect during the period of the contract and for six (6) years after its termination or cancellation. Section 15 Liability, I ndemnification and Insurance 15.The County and each Governmental Entity to this Agreement shall be solely liable for the acts of its elected officials, officers, employees, or agents and shall not be responsible for the acts of the other parties to this Agreement, their elected officials, officers, employees, or agents. 15.1. The provisions of the Municipal Tort Claims Act, Minnesota Statutes, Chapter 466 and other applicable laws govern liability of the Parties. To the full extent permitted by law, actions by the Parties, their respective officers, employees, and agents pursuant to this Agreement are intended to be and shall be construed as a “cooperative activity.” It is the intent of the Parties that they shall be deemed a “single governmental unit” for the purpose of liability as set forth in Minnesota Statutes, Section 471.59, subd. 1a(b). For the purpose of Minnesota Statutes, Section 471.59, subd, 1a(a), it is the intent that this Agreement does not create any liability or exposure to the Parties for the acts or omissions of the County or other individual Governmental Entity. 15.2. The County agrees to defend, hold harmless and indemnify the Governmental Entities and their officials, agents, and employees, from any liability, loss, or damages the Governmental Entity may suffer or incur as a result of demands, claims, judgments, or costs arising out of or caused by the County in the performance of its obligations under this Agreement. Page 5 of 6 Qbhf!228!pg!311 15.3. Each Governmental Entity agrees to defend, hold harmless and indemnify the County and its officials, agents, and employees, from any liability, loss, or damages the County may suffer or incur as a result of demands, claims, judgments, or costs arising out of or caused by its performance of its respective obligations under this Agreement. 15.4. Nothing in this Agreement shall be construed nor operate as a waiver of any applicable limitation of liability, defenses, immunities, or exceptions by statute or common law, nor does it impose or imply responsibility for the acts or omissions of the County or other Governmental Entities. The County and the Governmental Entities warrant that they are able to comply with the aforementioned indemnification requirements and have sufficient insurance coverage consistent with the liability limits contained in Minnesota Statutes, Chapter 466. Section 16 Survival of Provisions 16.It is expressly understood and agreed that Sections 8, 10, 14 and 15 hereof shall survive the completion of performance and termination or cancellation of this Agreement. Section 17 Authority 17.The person or persons executing this Agreement on behalf of the Governmental Entity and County represent that they are duly authorized to execute this Agreement on behalf of the Governmental Entity and the County and represent and warrant that this Agreement is a legal, valid and binding obligation and is enforceable in accordance with its terms. Each Party agrees that the electronic signatures of the Parties included in this Agreement are intended to authenticate this writing and to have the same force and effect as wet ink signatures. (Rest of page left intentionally blank. Signature pages to follow) Page 6 of 6 Qbhf!229!pg!311 IN WITNESS WHEREOF, the Parties hereto have hereunto set their hands. COUNTY OF DAKOTA By: __________________________________ Director, Public Services & Revenue Dated: APPROVED AS TO FORM: /s/ Thomas R. Donely By: ________________________________ Assistant Dakota County Attorney 10/2/2023 Dated: KS-23-495 Qbhf!22:!pg!311 CITY OF *** By: ****, Its Mayor Dated: By: ***, Its Clerk Dated: Qbhf!231!pg!311 TOWNSHIP OF *** By: ****, Its Board Chair Dated: By: ***, Its Clerk Dated: Qbhf!232!pg!311 SCHOOL DISTRT *** By: ****, Its Superintendent Dated: By: ***, Its Clerk Dated: Qbhf!233!pg!311 Absentee Voting Administration Division of Duties by Joint Powers Agreement Dakota County Elections Administration Center 1590 Highway 55 Hastings, MN 55033-2372 651-438-4305 elections@co.dakota.mn.us Version 8/24/2023 Qbhf!234!pg!311 Summary TopicDakota County Cities/Townships/School Districts Recurring Absentee Application The countywill send recurring (permanents) absentee ballot applications. Receiving regular applications The countywill process all mail If a city/township/school district for AB by mail, email or fax absentee ballot applications. receives an application for an absentee ballot to be mailed, they will scan and email the application to the county for processing. Online applicationsThe county will process all online applications. NOTE: the SVRS online module will not be available in odd years except in the case of a special election for a federal, state, or county office. UOCAVA applications The county will handle all aspects of UOCAVA voting. Mail absentee ballotsThe county will handle all aspects of absentee voting by mail including fulfillment, incidental correspondence, rejects, etc. Prepare materials for in-person County will prepare in-person, absentee postage paid absentee materials for use at city and school districts In-person absentee ballots The county will be an in-person Cities/townships/school districts absentee voting site for the entire which have regular office hours absentee period for all Dakota will maintain in-person absentee County residents. Offered at voting sites for the entire Hastings, Apple Valley and/or absentee voting period. West St. Paul, election location dependent. The county will provide regular courier services to collect city and school district absentee ballots to deliver to the County Absentee Ballot Board, for those entities with regular office hours. Direct balloting/Early Voting All County in-person absentee Direct balloting is discretionary. (In-person absentee ballots sites will offer direct ballotingfor cast in tabulator beginning 18 all county voters. days before election day) 1 Qbhf!235!pg!311 TopicDakota County Cities/Townships/School Districts Health Care Facility absentee Cities/townships/school districts voting will carry out health care facility voting. Safe at Home The county will manage all aspects of Safe at Home ballots. Agent Delivery and Return All in-person absentee sites will All in-person absentee sites will issue Agent Delivery and Return issue Agent Delivery and Return ballots. ballots to be couriered to the County. Absentee Ballot Board The county will establish the School districts that cross Absentee Ballot Board which will counties will be responsible for be responsible for all necessary all non-Dakota County ballots. duties to process Dakota County absentee ballots. Rejected Ballots The county will issue the replacement (only Dakota County ballots), to be returned by mail to DakotaCounty. Spoiled ballots If the voter’s original ballot has If the voter’s original ballot has already been accepted, the already been accepted, the county and city/township/ school county and city/township/school district will coordinate efforts so district will coordinate efforts so that the ballot is spoiled before that the ballot is spoiled before the voter is issued a replacement the voter is issued a replacement ballot. ballot. If the original ballot has not yet If the original ballot has not yet been accepted, the county will been accepted, the county will spoil and replace for mail spoil and replace for mail absentee voters, or the absentee voters, or the city/township/school district will city/township/school district will spoil and replace for in-person spoil and replace for in-person voters. voters. 2 Qbhf!236!pg!311 TopicDakota County Cities/Townships/School Districts Rosters and greeter lists Electronic roster files will be Cities/townships/school districts uploaded to the poll book will download the rosters to their management system, for poll books after the rosters are download to the poll books. generated and before the poll books are delivered to the Supplemental reports of voters election judges or polling places. with ballots accepted after the (Pollbook access points to be rosters are generated will be added to all large school district pushed to the poll books the day office) before election day and multiple times on election day. Cities/townships/school districts will work with the county to Rosters and Greeter lists will be ensure that on election day all delivered by vendor. poll books sync the AB roster supplement before the polls open and continue to sync throughout the day. Results The county will combine Cities/townships/school districts absentee results from all will be responsible to transmit absentee ballot counters to polling place results to the create one absentee result grand county. total. This AB total will be combined with polling place Cities/townships/school districts results and posted on the OSS will canvass reports against and Dakota County websites. original tapes and summary statements. Reports will be made available on the County SharePoint site in a Cities/townships/school districts timely manner to allow for will consult with the County canvassing within all deadlines. when scheduling canvass meetings. Storage The county will retain absentee Cities/townships/school districts ballots and related materials in will retain absentee ballots and their respective possession. related materials in their respective possession. In the event of a recount, materials will be transferred as In the event of a recount, soon as possible to the materials will be transferred as jurisdiction conducting the soon as possible to the recount. jurisdiction conducting the recount. 3 Qbhf!237!pg!311 EXECUTIVE SUMMARY City Council Regular Meeting: October 17, 2023 AGENDA ITEM: Request by Maplewood Development, Inc. for AGENDA SECTION: Approval of the Amber Fields 13th Addition CONSENT AGENDA Preliminary Plat and a Minor Amendment to the Planned Unit Development Agreement PREPARED BY: Julia Hogan, Planner AGENDA NO. 6.n. ATTACHMENTS: Resolutions, Minor PUD Amendment, Site Location, APPROVED BY: LJM Existing Conditions; Preliminary Plat; Phasing Plan; Site Plan; Preliminary Grading and Drainage Plan; Preliminary Utility Plan; Landscape Plan , City Engineer's Memo Dated September 7, 2023 RECOMMENDED ACTION: th 1. Motion to adopt a resolution approving the Preliminary Plat for Amber Fields 13 Addition, subject to the conditions in the resolution. 2. Motion to adopt a resolution approving a Minor Amendment to the Amber Fields Planned Unit Development Agreement. 3. Motion to authorize the Mayor and City Clerk to execute a Minor Amendment to the Amber Fields Planned Unit Development Agreement. BACKGROUND Owner: Earl Street Partners II, LLC. Preliminary Plat Acres: 14.68 Acres Met Council Acres: 14.68 Acres Residential Lots Created: 65 Single-Family Residential Lots Gross Density: 4.43 Units/Acre Net Density: 4.43 Units/Acre Comprehensive Plan Guiding: MUR-Mixed Use Residential Current Zoning: R1-Low Density Residential Surrounding Land Uses North: High Density Residential East: Mixed Use Residential South: Mixed Use Residential West: Mixed Use Residential Qbhf!241!pg!311 The City Council is being asked to consider a request by Maplewood Development for approval of a th preliminary plat for Amber Fields 13 Addition to create 65 single-family residential lots. This addition is one of eight different single-family lot subdivisions that is planned within the Amber Fields Development area. Staff is recommending approval of the request by the developer, subject to the conditions included in the recommended action and the Engineer’s Memo dated September 7, 2023, and subject to City Council approval of a Minor Amendment to the Amber Fields Planned Unit Development Agreement. PLANNING COMMISSION ACTION The Planning Commission reviewed the applicants' requests at its meeting on September 26, 2023, at which a public hearing was held to receive public comment. The Commission inquired about the minor amendment request to the Amber Fields PUD and what qualified the request to be a minor amendment over a major amendment. Staff informed the Commission that many factors go into deciding whether an amendment request is major or minor, but ultimately it is at the discretion of the Community Development Director via city code to decide if the request fits into the category of minor or major. The Commission also asked staff if there were any environmental concerns about approving decreased lot sizes, which staff explained that the City’s Engineering/Public Works department reviewed the submitted application and had no concerns with the request. The Commission also inquired about the landscaping requirements for this addition, and staff explained that the landscaping requirement would be required to be followed and that a condition of approval with the preliminary plat is a landscape surety to make sure the developer follows that requirement. Staff informed the Commission that the landscape plan that was submitted met the minimum requirements per the City’s code. The Commission did not receive any comments during the public hearing or prior to the meeting. The Planning Commission voted unanimously to recommend approval of the applicant's request. BACKGROUND The present applications are the latest step in a long process of planning for the development within UMore Park. The developer received Planned Unit Development approval with Rezoning from the City Council at its September 7, 2021, meeting. The Planned Unit Development anticipated roughly 1,959 residential units, which were to include a mixture of housing types such as single-family lots, townhome lots, and multi-family lots. There has been a total of 12 Amber Fields additions that have been approved by the City Council. Preliminary Plat Areas that have been approved by City Council ndrdthththththththth th include Amber Fields 2, 3, 4, 5, 6, 7 and 8 additions with additions 9, 10, 11and 12 being the remaining areas of the designated preliminary plat areas that are shown in the table below. There has been a total of 1,393 housing units approved so far within the Amber Fields Development Area and the table below shows the break down of units that have been approved per addition. Qbhf!242!pg!311 Amber Field Additions Housing Type Total Units Approved by City Council ndth Single Family and 301 units May 2022 and Amber Fields 2 and 12 Additions Townhome September 2023 rdth Single Family 182 units June 2022 and Amber Fields 3 and 11 Additions September 2023 thth Single Family 108 units July 2022 and April 2023 Amber Fields 4 and 9 Additions thth Single Family 124 units July 2022 and April 2023 Amber Fields 5 and 10 Additions th Multifamily 268 units July 2022 Amber Fields 6 Addition th Multifamily 250 units August 2022 Amber Fields 7 Addition th Multifamily 160 units December 2022 Amber Fields 8 Addition The developer is proposing 65 single family residential lots throughout the 14.68-acre section of the Amber Fields development area. This addition is located in the southeast portion of the development, extending north from the proposed connection road that will connect the Amber Fields Development th area to Akron Ave. This addition is also directly west from Akron Avenue. The Amber Fields 13 Addition subdivision is planned to be built out in two phases. The first phase will consist of the eastern portion of the site along with the connection road off of Akron Avenue and the eastern portion of the interior roadways. The second phase will consist of the remaining western portion of the site and the trail connection to the central greenway area. Legal Authority Preliminary Plat requests are quasi-judicial decisions for the Planning Commission, meaning that the Planning Commission is acting as a judge to determine if the regulations within the Comprehensive Plan, Zoning Ordinance and Subdivision Ordinance are being followed. Generally, if these applications meet the City’s established requirements, they must be approved. Staff’s review of each application is provided below. General Subdivision Design The preliminary plat area is located in the southeastern portion of the Amber Fields development area th directly west of Akron Avenue and north of 154 St W. The preliminary plat area is shown to be accessed by two public streets directly off of the future connection road to Akron Avenue currently called Road A. The proposed access road is shown as Road B and will extend from the southwest corner of the subdivision off of Road A and loop through the site back to Road A in the southeast corner. There is another street shown within the subdivision called Road C, this road will connect to the looped Road B. There is a 5-foot concrete sidewalk shown to be located throughout the site, as well as a trail in the northwest area of the site that will connect to the Greenway Area access trial. Land Use and Zoning The site is designated for MUR-Mixed Use Residential land uses, which can include a range of housing types from single-family homes on traditional sixty-five foot lots to townhomes. The zoning district in which the preliminary plat is located in is the R1-Low Density Residential zoning district. The Amber Fields Planned Unit Development Agreement includes several deviations from the Zoning Ordinance. Qbhf!243!pg!311 The applicant is requesting a Minor Amendment to the PUD to reduce the minimum lot width and to reduce the minimum lot area square footage. The proposed corner lots within the subdivision meet the Amber Fields PUD requirements for minimum lot width and minimum lot area but there are a few interior lots that do not meet the minimum 45 ft. lot width and 5,400 square foot lot area minimum. In addition to dimensional standards, the table below compares the proposed preliminary plat to the standards of the Amber Fields PUD. th Category Required (Amber Fields PUD) Amber Fields 13 Addition Min. Lot Area (sf) 5,400 (interior) 5,200 (interior) 7,200 (corner) 7,200 (corner) Min. Lot Width 45 ft. (interior) 40 ft. (interior) 55 ft. (corner) 55 ft. (corner) Min. Front Yard Setback 25 ft 25 ft. Min. Side Yard Setback 5 ft. dwelling/5 ft. garage/10 ft. corner 5 ft. dwelling and garage/20 ft. (45-ft. wide lots) for corner lots 10 ft. dwelling/5 ft. garage/20 ft. corner (55- and 65-ft. wide lots) Min. Rear Yard Setback 20 ft. 20 ft., 30 ft. for Block 3 Phasing The applicant has provided a phasing plan that shows development initially occurring in the southeastern portion of the preliminary plat area. This area contains 37 of the 65 proposed single- family lots. The connection road, and the eastern portion of Road B and C will be constructed with this th first phase of the 13 Addition. The second phase will consist of the remaining 28 single family lots and as well as the remaining portions of Road B, Road C and the access trail to the greenway area. Streets and Sidewalks th There are two proposed public streets going into the Amber Fields 13 Addition preliminary plat area with both of those streets extending from the future connection road that is currently called Road A. Road B extends from Road A in the southwest corner of the subdivision and loops through the site back to Road A in the southeast corner. Road C extends through the central portion of the site in between the looped Road B. th A five-foot sidewalk is proposed along the north side of Road A and spans along the whole 13 Addition up to Akron Avenue. There is also a sidewalk proposed along one side of Road B that loops throughout the whole subdivision and as well as a sidewalk along the north side of Road C. There is also a trail extension shown in between Lots 19 and 20, Block 1 of the site which will connect the subdivision to the adjacent trails for access to the central greenway area. Parks th The Parks and Recreation staff has reviewed the park dedication requirement for Amber Fields 13 Addition as part of the overall Master Development Plan in order to take into account the multiple Qbhf!244!pg!311 playgrounds and extensive open space within the development. Therefore, there is no park dedication requirement for this phase of Amber Fields. Preservation and Landscaping A tree inventory was conducted for the overall Amber Fields development area, and a total of 1,983 caliper inches of trees were identified for replacement following the formula laid out in the City Code. A total of 425 caliper inches of trees as mitigation has been provided throughout the Amber Fields Development area with 325 of those caliper inches being provided with the initial phase of th construction which included the construction of 148 Street West and the extension of Auburn th Avenue. 37.5 inches of caliper inches will be provided within the preliminary plat area of the 13 addition, leaving 1,520.5 caliper inches of trees needing to be provided as replacement throughout the remaining phases of Amber Fields. Staff is confident this will be met as development continues. The landscape plan submitted by the applicant shows a total of 88 trees to be planted throughout the preliminary plat area. The City code requires one tree per lot/frontage in the R1 and R2 zoning districts, which the landscape plan meets that requirement. A total of 88 trees will be planted with this addition, therefore a landscaping surety in the amount of $29,040 (88 trees x $300 plus 10%) is required as a condition of approval. Utilities The site will be served by existing sanitary sewer located within the connection Road A which extends west off of Akron Avenue. The sanitary sewer system extends within Road B from Road A and this extension provides service to the entire subdivision as it extends within the loop street of Road B and extends within Road C. Water will be provided to the site via an existing 8” watermain that is proposed to be extended within the streets of the preliminary plat area. Stormwater is managed across the entire site with detention and retention ponds located in the central open area of Amber Fields. Engineering Review The City’s engineer has provided a memorandum containing comments related to the plans provided. The memorandum included comments related to utilities, signage and street lighting, grading and general storm sewer design. A copy of the memorandum is included in the attachments. Additional comments from the City’s Engineering/Public Works department regarding this request included that the agreed-upon maintenance roles and responsibilities for trails, sidewalks and landscaping/irrigation will need to be followed and they will need to be conveyed to the future HOA that will be set up for this preliminary plat area. RECOMMENDATION The Planning Commission and staff are recommending approval of the preliminary plat for Amber th Fields 13 Addition, subject to conditions in the recommended action and contained within the Engineer’s memorandum dated September 7, 2023. The recommendation is based on information provided by the applicant and reviewed in this report. Qbhf!245!pg!311 CITY OF ROSEMOUNT DAKOTA COUNTY, MINNESOTA RESOLUTION 2023-XX A RESOLUTION APPROVING THE PRELIMINARY PLAT AND FINAL PLAT FOR AMBER FIELDS THIRTEENTH ADDITION WHEREAS, the City of Rosemount received a request for Preliminary Plat approval from Maplewood Development, concerning property legally described as: Outlot O, AMBER FIELDS, Dakota County, Minnesota WHEREAS, on September 26, 2023, the Planning Commission of the City of Rosemount held a public hearing and reviewed the Preliminary Plat for Amber Fields Thirteenth Addition; and WHEREAS, on September 26, 2023, the Planning Commission recommended approval of the Preliminary Plat for Amber Fields Thirteenth Addition, subject to conditions; and WHEREAS, on October 17, 2023, the City Council of the City of Rosemount reviewed the Planning NOW, THEREFORE, BE IT RESOLVED, the Council of the City of Rosemount hereby approves the Preliminary Plat for Amber Fields Thirteenth Addition, subject to the following conditions: a.!Conformance with all requirements of the City Engineer as detailed in the attached memorandum dated September 7, 2023. b.!Approval of a Minor Amendment to the Amber Fields Planned Unit Development Agreement. c.!Approval of the preliminary plat from the Dakota County Plat Commission. d.!Payment of $29,040 as a landscape surety. e.!Payment of trunk area charges in the amount of: i.!Sanitary Sewer Trunk Charge: $1,075/acre ii.!Watermain Trunk Charge: $6,500/acre iii.!Storm Sewer Trunk Charge: $6,865/acre th ADOPTED this 17 day of October 2023, by the City Council of the City of Rosemount. __________________________________________ Jeffery D. Weisensel, Mayor ATTEST: __________________________________ Erin Fasbender, City Clerk Qbhf!246!pg!311 CITY OF ROSEMOUNT DAKOTA COUNTY, MINNESOTA RESOLUTION 2023-XX A RESOLUTION APPROVING A MINOR AMENDMENT TO THE AMBER FIELDS PLANNED UNIT DEVELOPMENT AGREEMENT ALLOWING FOR RIVSED INTERIOR LOT TH STANDARDS FOR THE AMBER FIELDS 13 ADDITION PRELIMINARY PLAT AREA ! WHEREAS, the Community Development Department of the City of Rosemount received a request from Maplewood Development, Inc., to amend the Amber Fields Planned Unit Development Agreement to revise th the interior lots standards for the Amber Fields 13 Addition Preliminary Plat Area; and WHEREAS, staff has prepared and recommends a Minor PUD Amendment to reduce the interior lot standards th for the Amber Fields 13 Addition Preliminary Plat Area; and th WHEREAS, on October 17, 2023, the City Council of the City of Rosemount reviewed the application and staff recommendation. NOW, THEREFORE, BE IT RESOLVED, the City Council of the City of Rosemount hereby approves the Minor Amendment to the Amber Fields Planned Unit Development Agreement to revise the interior lot th standards for the Amber Fields 13 Addition Preliminary Plat Area; subject to the following conditions: 1.!The following deviations from the City Code: a.!A deviation from Section 11-4-5 F. 1. to reduce the minimum lot area to 5,200 square feet for interior lots. b.!A deviation from Section 11-4-5 F. 2. to reduce the minimum lot width to 40- feet for interior lots. 2.!Execution of the Minor Amendment to the Amber Fields Planned Unit Development Agreement. th ADOPTED this 17 day of October 2023, by the City Council of the City of Rosemount. __________________________________________ Jeffery D. Weisensel, Mayor ATTEST: ___________________________________ Erin Fasbender, City Clerk Qbhf!247!pg!311 A MINOR AMENDMENT TO THE AMBER FIELDS PLANNED UNIT DEVELOPMENT (PUD) AGREEMENT ALLOWING FOR RIVSED INTERIOR LOT TH STANDARDS FOR THE AMBER FIELDS 13 ADDITION PRELIMINARY PLAT AREA th THIS DECLARATION made this 17 day of October, 2023 by and between MAPLEWOOD DEVELOPMENT, INC., CITY OF ROSEMOUNT, a Minnesota municipal corporation (hereinafter referred to as the WHEREAS, Declarant is the owner of the real property described on Attachment One, and WHEREAS, the Subject Property is subject to a Planned Unit Development Agreement, th Amber Fields Master Development Plan dated September 7, 2021 and as amended on May 17, stththth 2022, June 21, 2022, July 19, 2022, August 16, 2022, September 6, 2022 and December 6, 2022 WHEREAS, Declarant wishes to further amend the Planned Unit Development Agreement as hereinafter provided, which amendment has been approved and consented to by the City of Rosemount, acting through its City Council, as evidenced by the duly authorized signatures of its officers affixed hereto. NOW, THEREFORE, the Declarant declares that the Subject Property is, and shall be, held, transferred, sold, conveyed and occupied subject to the covenants, conditions, and restrictions, hereinafter set forth. 1.!The use and development of the Subject Property shall conform to the Planned Unit Development Agreement except as modified herein. a.!The Planned Unit Development Agreement shall be amended to allow for the minimum lot area for interior lots to be 5,200 square feet instead of the required 5,400 square feet and to allow for the minimum lot width for interior lots to be 40 feet instead of the required 45 feet. 2.!Except as modified by paragraph 1 and 2 of this Amendment, the Planned Unit Development Agreement shall remain in full force and effect. 3.!The obligations and restrictions of this Amendment shall run with the land of the Subject Property and shall be enforceable against the Declarant, its successors and assigns, by the City of Rosemount acting through its City Council. This Amendment may be amended from time to time by a written amendment executed by the City and the owner or owners of the lot or lots to be affected by said amendment. Qbhf!248!pg!311 IN WITNESS WHEREOF, the undersigned as duly authorized agents, officers or representatives of Declarant have hereunto set their hands and seals as of the day and year first above written. DECLARANT _____________________________. By Its By Its STATE OF MINNESOTA ) ) ss. COUNTY OF DAKOTA ) The foregoing instrument was acknowledged before me this ___ day of _________, 2023 by _____________________ and _________________, the _________________ and ______________________, for and on behalf of ______________, a _________________ by and on behalf of said ________________. _______________________________ Notary Public This Amendment is approved and consented to by the City Council of the City of Rosemount. CITY OF ROSEMOUNT By: Jeffery D. Weisensel, Mayor And by: Erin Fasbender, City Clerk Qbhf!249!pg!311 STATE OF MINNESOTA ) ) ss. COUNTY OF DAKOTA ) The foregoing instrument was acknowledged before me this ___ day of ___________, 2023 by Jeffery D. Weisensel and Erin Fasbender, the Mayor and City Clerk, respectively, for and on behalf of the City of Rosemount, a Minnesota corporation, by and on behalf of said corporation. Notary Public THIS INSTRUMENT WAS DRAFTED BY: City of Rosemount th 2875 145 Street West Rosemount, MN 55068 651-423-4411 Qbhf!24:!pg!311 Qbhf!251!pg!311 Qbhf!252!pg!311 Qbhf!253!pg!311 Qbhf!254!pg!311 Qbhf!256!pg!311 Qbhf!257!pg!311 Qbhf!258!pg!311 Qbhf!259!pg!311 Qbhf!25:!pg!311 Qbhf!261!pg!311 Qbhf!263!pg!311 Qbhf!264!pg!311 Qbhf!265!pg!311 Qbhf!266!pg!311 Qbhf!267!pg!311 Qbhf!268!pg!311 Qbhf!269!pg!311 Memorandum Up;Csjbo!Fsjdltpo-!Djuz!Fohjoffs! Ojdl!Fhhfs-!Ejsfdups!pg!Qvcmjd!Xpslt! Bouipoz!Ofndfl-!Tfojps!Qmboofs! Kbof!Czspo-!Tupsn!Xbufs!Tqfdjbmjtu Gspn;Kfgg!Qfbstpo-!QF Cjmm!Bmnt-!QF Lfoesb!Gbmmpo-!QF Ebuf;Tfqufncfs!8-!3134 ui Sf;Bncfs!Gjfmet24Beejujpo!Djwjm!boe!TupsnxbufsQsfmjnjobsz!Qmbo!Sfwjfx XTC!Qspkfdu!Op/!134653.111 Xf!ibwf!sfwjfxfe!uif!epdvnfout!qspwjefe!cz!Bmmjbou!FohjoffsjohpoBvhvtu!25-!3134/! Epdvnfout!sfwjfxfe!jodmvef; ui Bncfs!Gjfmet!24Beejujpo!Qsfmjnjobsz!QmbuDjwjm!Tfu-!ebufe!902503134 ui Bncfs!Gjfmet!24Beejujpo!Sbujpobm!Tupsn!Tfxfs!Tj{joh!Dbmdvmbujpot<!voebufe Ju!tipvme!cf!opufe!uibu!uifsf!bsf!pvutuboejoh!dpnnfout!po!puifs!qsfwjpvtmz!tvcnjuufe!qpsujpot!pg! uif!efwfmpqnfou!uibu!tipvme!cf!beesfttfe/! Bqqmjdbou!tipvme!qspwjef!sftqpotft!upfbdi!dpnnfou/J!pggfs!uif!gpmmpxjoh!dpnnfout!cfmpx/ Civil Comments: 2/Hfofsbm b/Vqebuf!tusffu!obnft!xifo!bwbjmbcmf/ c/Qspwjef!cfodinbsl!fmfwbujpot!po!gvuvsf!dpotusvdujpo!qmbot/ d/ dpotusvdufe!dpoejujpot*!boe!vqebuf!bt!offefe!uispvhi!gvuvsf!qmbot/ e/Vqebuf!Djuz!efubjmt!up!dvssfou!3134!wfstjpo/ 3/Vujmjujft b/Bee!uif!OXM0IXM!jogpsnbujpo!gps!Xfumboe!29.117!boe!Cbtjo!4!up!uif!hsbejoh! qmbot!gps!sfgfsfodf/! c/Dpotjefs!bekvtujoh!tbojubsz!bmjhonfout!po!bmm!spbet!xifsf!offefe!up!lffq! xbufsnbjo!bmjhonfout!voefs!qbwfnfou!boe!bwpje!xbufsnbjo!bmjhonfou!cfofbui! tupsn!tfxfs!dbudi!cbtjot/ 4/Tjhobhf!boe!Tusffu!Mjhiujoh b/Bekvtu!tusffumjhiu!mpdbujpo!bu!Cmpdl!2-!Mpu!28029!up!Mpu!2:031!up!cf!ofbs!qbui! dpoofdujpo!)pggtfu!bt!offefe!up!bwpje!tupsn!tfxfs*/ 5/Mboetdbqf b/Op!dpnnfoutbu!uijt!ujnf L;\]134653.111\]Benjo\]Epdt\]134653.111!Bncfs!Gjfmet!24ui!Beejujpo!Qsfmjnjobsz!Qmbu!Qmbo!Sfwjfx!Nfnp!3134/1:/18/epdy Qbhf!26:!pg!311 ui Bncfs!Gjfmet!24!Beejujpo!Qsfmjnjobsz!Qmbo!Sfwjfx! Tfqufncfs!8-!3134 Qbhf!3! Grading, Drainage, and Erosion Control Comments: ! 6/!Hfofsbm! b/!Op!dpnnfout/! 7/!Qpoet!boe!Xfumboet! b/!Bee!uif!OXM0IXM!jogpsnbujpo!gps!Xfumboe!29.117!boe!Cbtjo!4!up!uif!hsbejoh! qmbot!gps!sfgfsfodf/!! 8/!Fnfshfodz!Pwfsgmpx!Spvuft;! b/!Op!dpnnfout/! 9/!Sfubjojoh!Xbmmt;! b/!Op!dpnnfout/!! :/!Fsptjpo!Dpouspm;! b/!Op!dpnnfout/! 21/!Hsbejoh;! ui b/!Uif!dpoupvst!tipvme!cf!beefe!gps!uif!bsfb!xftu!pg!uif!24!Beejujpo!po!uif! hsbejoh!qmbot!up!dpogjsn!uif!esbjobhf!dpoejujpo!cfijoe!uif!qspqptfe!ipnft! ui jodmvefe!jo!uif!24!Beejujpo/! c/!Ju!jt!sfdpnnfoefe!uif!mpx!qpjou!bmpoh!Spbe!C!cf!tijgufe!opsui!dmptfs!up!uif! xftufso!mpu!mjof!up!tijgu!DC!3:!bxbz!gspn!uif!qspqptfe!esjwfxbz/! d/!Qspwjef!hsbef!jogpsnbujpo!gps!txbmft!jo!pqfo!bsfbt!)njojnvn!3&*/! e/!Bee!dpoupvs!mbcfmt!)fyjtujoh!boe!qspqptfe*/! f/!Dpoupvst!po!Cmpdl!2-!Mput!2:.37!ep!opu!bmjho!xjui!qspqfsuz!mjoft!boe!ep!opu! sfgmfdu!qspqptfe!qbui/! Stormwater Management Plan: 2/!Hfofsbm!Tupsn!Tfxfs!Eftjho! b/!Qspwjef!b!dbudi!cbtjo!esbjobhf!bsfb!nbq!)jodmvejoh!uif!bsfb!joufoefe!up!esbjo!up! uif!qspqptfe!tuvct*!up!dpogjsn!tupsn!tfxfs!tj{joh/!! c/!Jodmvef!uif!qjqf!dbqbdjuz!)dgt*!jo!uif!tupsn!tfxfs!tj{joh!dbmdvmbujpot!up!dpnqbsf! xjui!uif!dvnvmbujwf!gmpx!sbuf!esbjojoh!up!uif!qjqf/!! d/!Nboipmft!po!uif!effq-!mbshf!ejbnfufs!tupsn!tfxfs!bsf!sfdpnnfoefe!up!cf! tqbdfe!b!nbyjnvn!pg!fwfsz!411!gffu!gps!fbtjfs!gvuvsf!nbjoufobodf/!Uijt!jt!uif! ui !Beejujpo/!! e/!Ju!jt!bttvnfe!DC!29!xjmm!dpoofdu!up!DCNI!28<!vqebuf!mjofxpsl!po!tupsn!tfxfs! qmbot/! f/!GFT!2!xjmm!sfrvjsf!tiffu!qjmjoh!evf!up!uif!qspqptfe!qjqf!tj{f<!uijt!tipvme!cf! jodmvefe!jo!gjobm!qmbu!qmbot/!! g/!Dpogjsn!boe!vqebuf!uif!dbtujoh!uzqf!boe!tusvduvsf!uzqf!opufe!jo!uif!tupsn!tfxfs! tdifevmf!gps!tusvduvsft!DC!29-!DCNI!28!boe!DCNI!27/! h/!Ju!jt!sfdpnnfoefe!NI!3!cf!tijgufe!tmjhiumz!bxbz!gspn!uif!qspqptfe!usbjm/!! 3/!Xbufs!Rvboujuz! b/!Op!dpnnfout/!! 4/!Sbuf0Wpmvnf!Dpouspm! b/!Op!dpnnfout/! 5/!Gsffcpbse! b/!Op!dpnnfout/! L;\]134653.111\]Benjo\]Epdt\]134653.111!Bncfs!Gjfmet!24ui!Beejujpo!Qsfmjnjobsz!Qmbu!Qmbo!Sfwjfx!Nfnp!3134/1:/18/epdy! Qbhf!271!pg!311 ui Bncfs!Gjfmet!24!Beejujpo!Qsfmjnjobsz!Qmbo!Sfwjfx! Tfqufncfs!8-!3134 Qbhf!4! 6/!Xbufs!Rvbmjuz! b/!Op!dpnnfout/! 7/!Fbtfnfout! b/!Fbtfnfou!ofbs!DCNI!38!tipvme!cf!vqebufe!up!qspwjef!21!gffu!tpvui!pg!uif! qspqptfe!tupsn!tfxfs!mjof!)ps!tusvduvsf!DCNI!38!tipvme!cf!tijgufe!up!uif!mpu!mjof! !tff!dpnnfou!qspwjefe!voefs!uif!hsbejoh!tfdujpo*/!! c/!Qspwjef!tusvduvsf!boe!qjqf!efqui!jogpsnbujpo!gps!uif!TUNI!bu!uif!cbdl!pg!Cmpdl! 2-!Mpu!21022!up!efufsnjof!jg!beejujpobm!fbtfnfou!jt!sfrvjsfe/! General ! Hvjefmjoft!boe!Tuboebset/!!Jogsbtusvduvsf!dpotusvdujpo!tibmm!cf!dpnqmfufe!jo!bddpsebodf!xjui!uif! e!Efubjm!Qmbuft!gps!Tusffu!boe!Vujmjuz! Dpotusvdujpo/! ! L;\]134653.111\]Benjo\]Epdt\]134653.111!Bncfs!Gjfmet!24ui!Beejujpo!Qsfmjnjobsz!Qmbu!Qmbo!Sfwjfx!Nfnp!3134/1:/18/epdy! Qbhf!272!pg!311 EXECUTIVE SUMMARY City Council Regular Meeting: October 17, 2023 AGENDA ITEM: Schafer Richardson Conduit Financing Authorization AGENDA SECTION: Request Amendment PUBLIC HEARINGS PREPARED BY: Adam Kienberger, Community Development AGENDA NO. 7.a. Director ATTACHMENTS: October 10, 2023 Amended Request Letter of APPROVED BY: LJM Explanation, Resolution, May 31, 2023 Initial Request Letter of Explanation RECOMMENDED ACTION: Motion to approve the attached resolution providing host approval for the issuance of revenue obligation bonds by the City of Columbus for the benefit of Adalyn Avenue, LLLP. BACKGROUND Schafer Richardson is pursuing development of a workforce housing multifamily project within the Prestwick Place development at the northeast corner of Akron Avenue and Connemara Trail. As part of their development plan they are assembling an array of financing and are requesting the city grant them authorization to secure conduit financing with the City of Columbus, Minnesota. City Council took action to approve this item after holding a public hearing on July 24, 2023. Attached is a letter of explanation of this process from the initial request along with an updated request as outlined by the developer's law firm Kennedy & Graven. Per the attached letter of explanation: "City Council previously provided host approval to the issuance of the Obligations by the Issuer in the principal amount of $30,570,000, including Obligations to be issued on a tax-exempt basis in the estimated amount of $24,570,000. However, since then, the Borrower has determined that it needs to increase the principal amount of the Obligations to be issued on a tax-exempt basis by an additional $6,000,000. Due to this increase, the City Council is required to conduct another public hearing to satisfy the requirements of state and federal tax law." RECOMMENDATION Staff recommends the City Council hold a public hearing and then approve the attached resolution providing host approval for the issuance of revenue obligation bonds by the City of Columbus for the benefit of Adalyn Avenue, LLLP. Qbhf!273!pg!311 Fifth Street Towers Offices in150 South Fifth Street, Suite 700 Minneapolis, MN 55402 Minneapolis(612) 337-9300 telephone (612) 337-9310 fax St. Cloudkennedy-graven.com Affirmative Action, Equal Opportunity Employer J ULIE A. E DDINGTON Attorney at Law Direct Dial: (612) 337-9213 Email: jeddington@kennedy-graven.com October 10, 2023 Adam Kienberger, Community Development Director Teah Malecha, Finance Director City of Rosemount th 2875 145 Street West Rosemount, MN 55068 Re:Resolution providing host approval to the issuance of revenue obligations by the City of Columbus for the benefit of Adalyn Avenue, LLLP Dear Adam and Teah, As you know, Adalyn Avenue, LLLP, a Minnesota limited liability limited partnership, or another related entity, affiliate, successor, or assign of SRPB Strategic Housing, LLC, a Minnesota limited liability company (collectively, the “Borrower”), intends to acquire, construct, and equip an approximately 164-unit multifamily housing development and facilities functionally related and subordinate thereto to be located at or about 14203 Adalyn Avenue, Rosemount, Minnesota, for occupancy by individuals and families of low and moderate income, to be known as Croft at Rosecott (the “Project”). In order to finance the Project, the Borrower has proposed that the City of Columbus, Minnesota (the “Issuer”) issue one or more series of tax-exempt revenue obligations (the “Obligations”) and loan the proceeds thereof to the Borrower. In order for the Issuer to issue the Obligations to finance a project located in the City of Rosemount, Minnesota (the “City”), the City Council of the City must first grant “host approval” to the issuance of the Obligations, as required by state and federal tax law. On July 24, 2023, following a public hearing, the City Council previously provided host approval to the issuance of the Obligations by the Issuer in the principal amount of $30,570,000, including Obligations to be issued on a tax-exempt basis in the estimated amount of $24,570,000. However, since then, the Borrower has determined that it needs to increase the principal amount of the Obligations to be issued on a tax-exempt basis by an additional $6,000,000. Due to this increase, the City Council is required to conduct another public hearing to satisfy the requirements of state and federal tax law. The Obligations will be issued pursuant to Minnesota Statutes, Chapters 462C and 474A, as amended (the “Act”), and Minnesota Statutes, Sections 471.59 and 471.656, as amended (the “Joint Powers Act”). The Joint Powers Act provides authorization for the Issuer to issue the Obligations even though the Project is located outside of the general jurisdiction of the Issuer. The Borrower is requesting that the City Council consider the enclosed resolution following the public hearing to be held on October 17, 2023, in accordance with Section 147(f) of the Internal Revenue Code of 1986, as amended (the “Code”), and the Act. This resolution provides the City’s consent to the issuance of the Obligations by the Issuer to finance the Project, as located in the City, as well as its approval of a joint housing program with the Qbhf!274!pg!311 Issuer, which describes the funding mechanisms for the Project and how the Project will meet the needs of low- and moderate-income families. The resolution also authorizes the execution of a cooperative agreement (also referred to as a “joint powers agreement”) with the Issuer to satisfy the requirements of the Joint Powers Act. The Issuer, as the conduit issuer of the Obligations, will conduct a public hearing to satisfy the requirements of the Code and the Act on October 25, 2023. The Obligations will be secured solely by the revenues pledged pursuant to a loan or revenue agreement to be executed by the Issuer and the Borrower and from other security provided by the Borrower. The Obligations will not constitute a general or moral obligation of the City, will not be secured by or payable from any property or assets of the City, and will not be secured by any taxing power of the City. The Obligations will not have any adverse impact on the credit rating of the City, even in the event that the Borrower encounters financial difficulties with respect to the Project. The issuance of the Obligations by the Issuer will not affect the City’s ability to issue general obligation bonds in calendar year 2023. Furthermore, the issuance of the Obligations by the Issuer will not affect the ’s ability to designate up to $10,000,000 in tax-exempt bonds as “qualified tax-exempt obligations” “bank-qualified bonds”) for calendar year 2023. The Borrower will agree to pay the out-of-pocket expenses of the City with respect to this transaction. Julie Eddington will attend the public hearing on October 17, 2023. Please contact me with any questions you may have prior to the City Council meeting. Sincerely, Julie A. Eddington CL290-18 (JAE) 908065v1 2 Qbhf!275!pg!311 CITY OF ROSEMOUNT, MINNESOTA RESOLUTION NO. _____ RESOLUTION PROVIDING HOST APPROVAL TO AND CONSENTING TO THE ISSUANCE BY THE CITY OF COLUMBUS OF ITS REVENUE OBLIGATIONS FOR THE BENEFIT OF ADALYN AVENUE, LLLP; APPROVING A HOUSING PROGRAM; APPROVING AND AUTHORIZING THE EXECUTION OF A COOPERATIVE AGREEMENT; AND TAKING OTHER ACTIONS WITH RESPECT THERETO BE IT RESOLVED by the City Council of the City of Rosemount, Minnesota (the “City”) as follows: Section 1.Recitals. 1.01.Pursuant to the Constitution and laws of the State of Minnesota, particularly Minnesota Statutes, Chapter 462C, as amended (the “Housing Act”), a municipality is authorized to issue revenue bonds or obligations to finance multifamily housing developments. 1.02.Minnesota Statutes, Section 471.656, as amended, authorizes a municipality to issue obligations to finance the acquisition or improvement of property located outside of the corporate boundaries of such municipality if the obligations are issued under a joint powers agreement between the municipality issuing the obligations and the municipality in which the property to be acquired or improved is located. 1.03.Pursuant to Minnesota Statutes, Section 471.59, as amended, by the terms of a joint powers agreement entered into through action of their governing bodies, two or more municipalities may jointly or cooperatively exercise any power common to the contracting parties or any similar powers, including those which are the same except for the territorial limits within which they may be exercised and the joint powers agreement may provide for the exercise of such powers by one or more of the participating governmental units on behalf of the other participating units. 1.04.Adalyn Avenue, LLLP, a Minnesota limited liability limited partnership, or another related entity, affiliate, successor, or assign of SRPB Strategic Housing, LLC, a Minnesota limited liability company (collectively, the “Borrower”), has proposed that the City approve the issuance by the City of Columbus, Minnesota (the “Issuer”) of one or more series of tax-exempt or taxable revenue obligations (the “Obligations”) in the approximate maximum principal amount of $35,000,000, for the benefit of the Borrower for the purposes of financing all or a portion of (a) the costs of the acquisition, construction, and equipping of an approximately 164-unit multifamily housing development and facilities functionally related and subordinate thereto to be located at or about 14203 Adalyn Avenue in the City for occupancy by individuals and families of low and moderate income, to be known as Croft at Rosecott (the “Project”); (b) any required reserves; (c) capitalized interest during the construction and lease-up of the Project, if necessary; and (d) the costs of issuing the Obligations. 1.05.Section 147(f) of the Internal Revenue Code of 1986, as amended (the “Code”), and regulations promulgated thereunder require that, prior to the issuance of the Obligations, the City Council must consent to the issuance of the Obligations by the Issuer after conducting a public hearing thereon Qbhf!276!pg!311 preceded by publication of a notice of public hearing (in the form required by Section 147(f) of the Code and applicable regulations) in a newspaper of general circulation within the City at least seven (7) days prior to the public hearing date. 1.06.In accordance with the Housing Act, a housing program (the “Housing Program”) to authorize the issuance by the Issuer of the Obligations to finance the costs of the Project has been prepared and is on file with the City Council. Kennedy & Graven, Chartered, as bond counsel to the Issuer (“Bond Counsel”), has published, on behalf of the City, a notice of public hearing on the Housing Program and the issuance of the Obligations by the Issuer in the Dakota County Tribune, the official newspaper of and a newspaper of general circulation in the City, at least fifteen (15) days before the regularly scheduled meeting of the City Council on the date hereof, with respect to the required public hearing under Section 147(f) of the Code. 1.07.On the date hereof, the City Council conducted a public hearing at which a reasonable opportunity was provided for interested individuals to express their views, both orally and in writing, on providing consent to the issuance of the Obligations by the Issuer pursuant to the requirements of Section 147(f) of the Code and the regulations promulgated thereunder and approving the Housing Program. 1.08.To satisfy the requirements of Minnesota Statutes, Sections 471.59 and 471.656, as amended, the City and the Issuer are proposing to enter into a Cooperative Agreement (the “Cooperative Agreement”) pursuant to which the City will consent to the issuance of the Obligations by the Issuer to finance the Project, and the Issuer will agree to issue the Obligations to finance the Project. A form of the Cooperative Agreement is on file with the City Council. 1.09.The Borrower has represented to the City that the principal of, premium (if any), and interest on the Obligations (i) shall be payable solely from the revenue pledged therefor; (ii) shall not constitute a debt of the City or the Issuer within the meaning of any constitutional or statutory limitation; (iii) shall not constitute nor give rise to a pecuniary liability of the City or the Issuer or a charge against the general credit or taxing powers of either; and (iv) shall not constitute a charge, lien, or encumbrance, legal or equitable, upon any property of the City or the Issuer other than the interest of the Issuer as set forth in one or more loan agreements to be entered into between the Issuer and the Borrower. Section 2.Approvals. 2.01.The City Council finds that it is in the best interest of the City to approve the issuance of the Obligations by the Issuer to finance the Project and hereby consents to the issuance of the Obligations by the Issuer for the purposes set forth above. 2.02.The Obligations shall be special, limited obligations of the Issuer payable solely from the revenues and security provided by the Borrower to the Issuer and pledged to the payment of the Obligations. 2.03.The Housing Program is hereby approved. 2.04.The Mayor and the City Administrator are hereby authorized and directed to execute and deliver the Cooperative Agreement and any other documents deemed necessary to fulfill the intentions of this resolution. All of the provisions of the Cooperative Agreement, when executed and delivered as authorized herein, shall be deemed to be a part of this resolution as fully and to the same extent as if 2 Qbhf!277!pg!311 incorporated verbatim herein and shall be in full force and effect from the date of execution and delivery thereof. The Cooperative Agreement shall be substantially in the form on file with the City, which is hereby approved, with such omissions and insertions as do not materially change the substance thereof, or as the Mayor and the City Administrator, in their discretion, shall determine, and the execution thereof by the Mayor and the City Administrator shall be conclusive evidence of such determination. 2.05.The Mayor and the City Administrator and other officers, employees, and agents of the City are hereby authorized and directed to prepare and furnish to bond counsel, the trustee, and the original purchaser of the Obligations certified copies of all proceedings and records of the City relating to the approval of the issuance of the Obligations, including a certification of this resolution. 2.06.The Borrower shall pay to the City any and all costs paid or incurred by the City in connection with this resolution, the Housing Program, the Cooperative Agreement, the Obligations or the financing contemplated herein, whether or not the financing is carried to completion, and whether or not the Obligations or operative instruments are executed and delivered. 2.07.This resolution replaces the resolution adopted by the City Council on July 24, 2023, approving the issuance of the Obligations on a tax-exempt basis in the estimated maximum principal amount of $24,570,000. 2.08.This resolution shall be in full force and effect from and after its passage. th Approved by the City Council of the City of Rosemount, Minnesota this 17 day of October, 2023. Mayor ATTEST: City Clerk CL290-18 (JAE) 902939v2 3 Qbhf!278!pg!311 Fifth Street Towers Offices in150 South Fifth Street, Suite 700 Minneapolis, MN 55402 Minneapolis(612) 337-9300 telephone (612) 337-9310 fax St. Cloudkennedy-graven.com Affirmative Action, Equal Opportunity Employer J ULIE A. E DDINGTON Attorney at Law Direct Dial (612) 337-9213 Email: jeddington@kennedy-graven.com May 31, 2023 Adam Kienberger, Community Development Director City of Rosemount th 2875 145 Street West Rosemount, MN 55068 Re:Resolution calling a public hearing to consider host approval for the issuance of revenue obligations by the City of Columbus for the benefit of SRPB Strategic Housing LLC Dear Adam, SRPB Strategic Housing LLC, or a related entity, affiliate, successor, or assign (collectively, the “Borrower”), intends to acquire, construct, and equip an approximately 164-unit multifamily housing development and facilities functionally related and subordinate thereto to be located at northeast intersection of Akron Avenue and Connemara Trail, Rosemount, Minnesota, for occupancy by individuals and families of low and moderate income, to be known as Croft at Rosecott (the “Project”). The Dakota County Community Development Agency (the “County CDA”) issues conduit bonds to finance affordable housing developments located within Dakota County, Minnesota (the “County”). However, the County CDA is an “entitlement issuer” and has already committed to issuing bonds for other affordable housing projects, which has exhausted the amount of funds that it has received through the State of Minnesota for this purpose. As a result, the County CDA is requiring that the Borrower approach a “conduit issuer” outside of Dakota County to issue conduit revenue bonds to provide financing for the Project. In order to finance the Project, the Borrower has proposed that the City of Columbus, Minnesota (the “Issuer”) issue one or more series of tax-exempt revenue obligations in the approximate maximum principal amount of $29,000,000 and, if necessary, one or more series of taxable revenue obligations in the approximate maximum principal amount to be determined (collectively, the “Obligations”) and loan the proceeds thereof to the Borrower. In order for the Issuer to issue the Obligations to finance a project located in the City of Rosemount, Minnesota (the “City”), the City Council of the City must first grant “host approval” to the issuance of the Obligations, as required by state and federal tax law. The Obligations will be issued pursuant to Minnesota Statutes, Chapters 462C and 474A, as amended (the “Act”), and Minnesota Statutes, Sections 471.59 and 471.656, as amended (the “Joint Powers Act”). The Joint Powers Act provides authorization for the Issuer to issue the Obligations even though the Project is located outside of the general jurisdiction of the Issuer. As a part of this process, the City Council will be asked to conduct a public hearing for “host approval” pursuant to Section 147(f) of the Internal Revenue Code of 1986, as amended (the “Code”), and for a joint housing program with the Issuer pursuant to the Act, which describes the funding mechanisms for the Project and how the Project will meet the needs of Qbhf!279!pg!311 low and moderate-income families. The Issuer, as the conduit issuer of the Obligations, will also conduct a public hearing to satisfy the requirements of the Code and the Act. The Borrower is requesting that the City Council consider the enclosed resolution at its meeting on June 6, 2023, which calls for the public hearing to be conducted by the City Council at its meeting on July 24, 2023. Following the public hearing, the City Council will be asked to consider a resolution (i) approving the joint housing program with the Issuer to satisfy the requirements of Section 462C.03 of the Act; (ii) providing “host approval” to the issuance of the Obligations by the Issuer to finance the Project; and (iii) authorizing the execution and delivery of a Joint Powers Agreement (also referred to as a “Cooperative Agreement”) with the Issuer to satisfy the requirements of the Joint Powers Act. The Joint Powers Agreement is a short agreement by which the City will consent to the issuance of the Obligations by the Issuer, and the Issuer will agree to issue the Obligations to finance the Project. The Obligations will be secured solely by the revenues pledged pursuant to a loan or revenue agreement to be executed by the Issuer and the Borrower and from other security provided by the Borrower. The Obligations will not constitute a general or moral obligation of the City, will not be secured by or payable from any property or assets of the City, and will not be secured by any taxing power of the City. The Obligations will not have any adverse impact on the credit rating of the City, even in the event that the Borrower encounters financial difficulties with respect to the Project. The issuance of the Obligations by the Issuer will not affect the City’s ability to issue general obligation bonds in calendar year 2023. Furthermore, the issuance of the Obligations by the Issuer will not affect the ’s ability to designate up to $10,000,000 in tax-exempt bonds as “qualified tax-exempt obligations” “bank-qualified bonds”) for calendar year 2023. The Borrower will agree to pay the out-of-pocket expenses of the City with respect to this transaction. Please contact me with any questions you may have prior to the City Council meeting. Sincerely, Julie A. Eddington CL290-18 (JAE) 879474v1 2 Qbhf!27:!pg!311 EXECUTIVE SUMMARY City Council Regular Meeting: October 17, 2023 AGENDA ITEM: Request by SKB Environmental for an extension of AGENDA SECTION: its current Interim Use Permit PUBLIC HEARINGS PREPARED BY: Anthony Nemcek , Senior Planner AGENDA NO. 7.b. ATTACHMENTS: Resolution, Site Location, MPCA Correspondence, APPROVED BY: LJM Current 2018 Interim Use Permit RECOMMENDED ACTION: Motion to adopt a resolution approving an extension of the 2018 Interim Use Permit for SKB Environmental. BACKGROUND The City Council approved SKB’s current Interim Use Permit in 2018 with a term of 5 years. Ahead of the November 2023 expiration of the IUP, SKB applied for and received approval for a new IUP that includes an expansion of the current operation. That approval was conditioned on receiving the necessary permits from the Minnesota Pollution Control Agency (MPCA). Based on correspondence City staff have reviewed between SKB and the MPCA, it appears staffing turnover is delaying the review process at the MPCA, specifically the portion of the review related to groundwater and hydrogeology within the expansion area. That correspondence going back to February of this year is included in the attachments. Following the MPCA’s issuance of a permit, Dakota County needs to issue the license for the expansion. The issuance of the permit by the County is estimated to take 30-45 days. Until the permit is issued, the latest IUP renewal that was approved in 2022 will not be in effect. An extension of the IUP that is currently in effect is necessary to ensure SKB can continue its operation while the MPCA finalizes its review of the expansion. SKB has requested the current IUP be extended to June 30, 2024. Section 11- 10-8 of the City Code allows the Council, after a public hearing, to modify standards or conditions of interim use permits, including extending the term of a permit so long as such modification “will not impair the intent and purpose of such standards or conditions and is consistent with reasonable enjoyment of adjacent property.” The extension of the term of the current IUP would not permit any changes to SKB’s current operation, and would not create additional impairments on adjacent properties. RECOMMENDATION Staff has reviewed the correspondence between the MPCA and SKB and finds an extension of the current IUP approved in 2018 to be justified. Staff recommends the City Council adopt a resolution approving an extension of the current IUP to June 30, 2024 subject to all other conditions contained within the attached Interim Use Permit. Qbhf!281!pg!311 CITY OF ROSEMOUNT DAKOTA COUNTY, MINNESOTA RESOLUTION 2023-XX A RESOLUTION APPROVING AN EXTENSION OF THE SKB ENVIRONMENTAL INTERIM USE PERMIT FOR THE OPERATION OF A WASTE FACILITY. WHEREAS, the City of Rosemount received request from SKB Environmental, Inc. (SKB) for an extension of the term of the Interim Use Permit (IUP) associated their waste facility located at 13425 Courthouse Boulevard, Rosemount, Minnesota; and WHEREAS, the IUP allows the disposal of industrial waste, municipal solid waste (MSW) incinerator ash, and construction and demolition debris and the operation of a recycling and transfer facility handling the previously mentioned wastes along with MSW; and WHEREAS, the City Code allows t he council, after public hearing, to modify standards or conditions required for the IUP, provided, that such modification will not impair the intent and purpose of such standards or conditions and is consistent with reasonable enjoyment of adjacent property; and WHEREAS, on October 17, 2023, the City Council of the City of Rosemount held a public hearing to review the modification of the IUP from SKB. NOW, THEREFORE, BE IT RESOLVED, the Council of the City of Rosemount hereby approves an extension of the term of the IUP for SKB Environmental waste facility located at 13425 Courthouse Boulevard, Rosemount, Minnesota, subject to the conditions in the Interim Use Permit Reissuance to SKB, Inc. Minnesota Industrial Containment Facility and including the conditions as follows: 1)The Interim Use Permit shall expire on June 30, 2024. 2)The Interim Use Permit approved by Council in 2022 shall not go into effect until all necessary permits required by the MPCA and Dakota County are granted and the IUP is fully executed. th ADOPTED this 17 day of October, 2023 by the City Council of the City of Rosemount. __________________________________________ Jeffery D. Weisensel, Mayor ATTEST: ___________________________________ Erin Fasbender, City Clerk Qbhf!282!pg!311 Qbhf!283!pg!311 Anthony Nemcek From:Aamodt, Daniel (MPCA) <daniel.aamodt@state.mn.us> Sent:Thursday, August 24, 2023 9:25 AM To:Ryan O'Gara; Geoff Strack Cc:Shustarich, Thomas; Gawrys, Elizabeth (MPCA); Short, Alexander K (MPCA) Subject: RE: SKB Rosemount 2022 Major Modification Technical Adequacy Letter HiRyan, Wewanttoincludetimeforreviewingthehydroinvestigation,preparingthedraftpermit,andallowingSKBtoreview andcommentonthedraftpermitpriortothepublicnotice.If{Y.͸ƭresponsesthetechnicalreviewareadequateand thereareonlyminorrevisionsneededtothedraftpermitIthinkźƷ͸ƭreasonabletoplanonputtingthedraftpermiton publicnoticeinearlywinter. DanAamodt Engineer,SolidWastePermittingUnit ResourceManagement&AssistanceDivision MinnesotaPollutionControlAgency 520LafayetteRd St.Paul,MN55155 6517572435 daniel.aamodt@state.mn.us NOTICE:Thisemail(includingattachments)iscoveredbytheElectronicCommunicationsPrivacyAct,18U.S.C. 25102521.Thisemailmaybeconfidentialandmaybelegallyprivileged.Ifyouarenottheintendedrecipient,you areherebynotifiedthatanyretention,dissemination,distribution,orcopyingofthiscommunicationisstrictly prohibited.Pleasereplybacktothesenderthatyouhavereceivedthismessageinerror,thendeleteit.Thankyou. CƩƚƒʹRyanO'Gara<Ryan.O'Gara@WasteConnections.com> {ĻƓƷʹWednesday,August23,20233:05PM ƚʹAamodt,Daniel(MPCA)<daniel.aamodt@state.mn.us>;GeoffStrack<Geoffrey.Strack@WasteConnections.com> /ĭʹShustarich,Thomas<thomas.shustarich@stantec.com>;Gawrys,Elizabeth(MPCA)<elizabeth.gawrys@state.mn.us>; Short,AlexanderK(MPCA)<Alexander.Short@state.mn.us> {ǒĬƆĻĭƷʹRE:SKBRosemount2022MajorModificationTechnicalAdequacyLetter ThanksDan,thisisgreatnews! Alex&DanjustsoIcanprovideourneighborswithanestimatedtimeline,doyouhaveanyideaofwhenwemightgo onpublicnotice?Evenaroughestimatewouldhelpputtheirmindsatease. Thanks! Ryan CƩƚƒʹAamodt,Daniel(MPCA)<daniel.aamodt@state.mn.us> {ĻƓƷʹTuesday,August22,20234:10PM ƚʹGeoffStrack<Geoffrey.Strack@WasteConnections.com> /ĭʹRyanO'Gara<Ryan.O'Gara@WasteConnections.com>;Shustarich,Thomas<thomas.shustarich@stantec.com>; Gawrys,Elizabeth(MPCA)<elizabeth.gawrys@state.mn.us>;Short,AlexanderK(MPCA)<Alexander.Short@state.mn.us> {ǒĬƆĻĭƷʹRE:SKBRosemount2022MajorModificationTechnicalAdequacyLetter Geoff,AlexShorthasbeenassignedtoreviewthehydrogeologicportionsofthepermitapplication.Hewillreachouttoyoudirectlyifhehasanyimmediatequestions.Ifthereareanycommentsoraneedforadditionalinformationthiswi ll Geoff, AlexShorthasbeenassignedtoreviewthehydrogeologicportionsofthepermitapplication.Hewillreachouttoyou directlyifhehasanyimmediatequestions.Ifthereareanycommentsoraneedforadditionalinformationthiswillbe summarizedinaTechnicalAdequacylettersenttoSKBuponcompletionofthereviewofthehydrogeologic investigationreport. DanAamodt Engineer,SolidWastePermittingUnit ResourceManagement&AssistanceDivision 1 Qbhf!284!pg!311 MinnesotaPollutionControlAgency 520LafayetteRd St.Paul,MN55155 6517572435 daniel.aamodt@state.mn.us NOTICE:Thisemail(includingattachments)iscoveredbytheElectronicCommunicationsPrivacyAct,18U.S.C. 25102521.Thisemailmaybeconfidentialandmaybelegallyprivileged.Ifyouarenottheintendedrecipient,you areherebynotifiedthatanyretention,dissemination,distribution,orcopyingofthiscommunicationisstrictly prohibited.Pleasereplybacktothesenderthatyouhavereceivedthismessageinerror,thendeleteit.Thankyou. CƩƚƒʹGeoffStrack<Geoffrey.Strack@WasteConnections.com> {ĻƓƷʹMonday,August21,20232:38PM ƚʹAamodt,Daniel(MPCA)<daniel.aamodt@state.mn.us> /ĭʹRyanO'Gara<Ryan.O'Gara@WasteConnections.com>;Shustarich,Thomas<thomas.shustarich@stantec.com>; Gawrys,Elizabeth(MPCA)<elizabeth.gawrys@state.mn.us> {ǒĬƆĻĭƷʹRE:SKBRosemount2022MajorModificationTechnicalAdequacyLetter Checkinginonthestatusofthereviewandfindingahydrotoreview.Wehavesomeanxiousneighborsthatareasking usabouttheprocess. Thanks. GeoreyStrack RegionEngineer CƩƚƒʹAamodt,Daniel(MPCA)<daniel.aamodt@state.mn.us> {ĻƓƷʹTuesday,July25,202311:55AM ƚʹGeoffStrack<Geoffrey.Strack@WasteConnections.com> /ĭʹRyanO'Gara<Ryan.O'Gara@WasteConnections.com>;Shustarich,Thomas<thomas.shustarich@stantec.com>; Gawrys,Elizabeth(MPCA)<elizabeth.gawrys@state.mn.us> {ǒĬƆĻĭƷʹRE:SKBRosemount2022MajorModificationTechnicalAdequacyLetter Geoff,L͸ƒcontinuingtoworkondraftingthepermitasmuchaspossible.IhavewrappedupissuinganothermajorpermitsonowIwillbeabletodedicatemoretimetotheSKBRosemountExpansionProject.Unfortunatelythehydrogeologist Geoff, L͸ƒcontinuingtoworkondraftingthepermitasmuchaspossible.Ihavewrappedupissuinganothermajorpermitso nowIwillbeabletodedicatemoretimetotheSKBRosemountExpansionProject.Unfortunatelythehydrogeologist assignedtothefacilityrecentlylefttheMPCA.Ihavecommunicatedtomysupervisorthatanewhydrogeologistwill needtobeassignedassoonaspossibletocompletethereviewoftheHydrogeologicInvestigationReportandassistin draftingthegroundwatermonitoringportionsofthepermit. Iwillkeepyouinformedonthestatusofthehydrofortheprojectandprovideapreliminarydraftpermit(minus anythingrelatedtogroundwatermonitoring)assoonasitisprepared. Thanks, DanAamodt Engineer,SolidWastePermittingUnit ResourceManagement&AssistanceDivision MinnesotaPollutionControlAgency 520LafayetteRd St.Paul,MN55155 6517572435 daniel.aamodt@state.mn.us NOTICE:Thisemail(includingattachments)iscoveredbytheElectronicCommunicationsPrivacyAct,18U.S.C. 25102521.Thisemailmaybeconfidentialandmaybelegallyprivileged.Ifyouarenottheintendedrecipient,you areherebynotifiedthatanyretention,dissemination,distribution,orcopyingofthiscommunicationisstrictly prohibited.Pleasereplybacktothesenderthatyouhavereceivedthismessageinerror,thendeleteit.Thankyou. CƩƚƒʹGeoffStrack<Geoffrey.Strack@WasteConnections.com> {ĻƓƷʹMonday,July24,202312:48PM ƚʹAamodt,Daniel(MPCA)<daniel.aamodt@state.mn.us> /ĭʹRyanO'Gara<Ryan.O'Gara@WasteConnections.com>;Shustarich,Thomas<thomas.shustarich@stantec.com> {ǒĬƆĻĭƷʹRE:SKBRosemount2022MajorModificationTechnicalAdequacyLetter 2 Qbhf!285!pg!311 Dan, Checkinginonthestatusofadraftpermit. Thanks. GeoffreyStrack RegionEngineer CƩƚƒʹGeoffStrack {ĻƓƷʹThursday,July6,202312:47PM ƚʹAamodt,Daniel(MPCA)<daniel.aamodt@state.mn.us> /ĭʹRyanO'Gara<Ryan.O'Gara@WasteConnections.com>;Shustarich,Thomas<thomas.shustarich@stantec.com> {ǒĬƆĻĭƷʹRE:SKBRosemount2022MajorModificationTechnicalAdequacyLetter Dan, Checkinginonyourprogressonadraftpermit. Thanks. GeoffreyStrack RegionEngineer CƩƚƒʹAamodt,Daniel(MPCA)<daniel.aamodt@state.mn.us> {ĻƓƷʹThursday,April20,202310:20AM ƚʹGeoffStrack<Geoffrey.Strack@WasteConnections.com> /ĭʹRyanO'Gara<Ryan.O'Gara@WasteConnections.com>;Shustarich,Thomas<thomas.shustarich@stantec.com> {ǒĬƆĻĭƷʹRE:SKBRosemount2022MajorModificationTechnicalAdequacyLetter Geoff,IreviewedtheresponsesSKBprovidedtothetechnicalreviewletter.Iwassatisfiedwiththemajorityoftheresponsesbuthadsomeconcernswiththeresponsesforitemthree(permittedcapacity)anditemthirteen(hydrogeolog icinvestigation) Geoff, IreviewedtheresponsesSKBprovidedtothetechnicalreviewletter.Iwassatisfiedwiththemajorityoftheresponses buthadsomeconcernswiththeresponsesforitemthree(permittedcapacity)anditemthirteen(hydrogeologic investigation)soIbroughttheseitemstoourengineeringforumfordiscussion.Wedecidedthattheresponseprovided forpermittedcapacitywassatisfactoryandIwillmoveforwardusingtheproposed29,106,451cubicyardsasthe permittedcapacityforindustrialwaste.HowevertheMPCAstillhasconcernsaboutplacingapermitonpublicnotice withoutarequiredhydrogeologicinvestigationfortheexpansionarea. IcancontinueworkingonadraftpermitforyourreviewwhileSKBandStanteccontinueworkingtocompletethe hydrogeologicinvestigation.Ianticipatehavingapreliminarydraftofthepermitreadyin3to4weeks.AtthepointIcan provideitfor{Y.͸ƭpreliminaryreviewandwecanhaveadiscussiononwheretheinvestigationisandonpossiblepaths movingforward. IwillreachouttoyouifIhaveanyquestionswhileL͸ƒdraftingthepermitandfeelfreetocontactmeifyouhaveany additionalconcerns. Thanks, DanAamodt Engineer,SolidWastePermittingUnit ResourceManagement&AssistanceDivision MinnesotaPollutionControlAgency 520LafayetteRd St.Paul,MN55155 6517572435 daniel.aamodt@state.mn.us NOTICE:Thisemail(includingattachments)iscoveredbytheElectronicCommunicationsPrivacyAct,18U.S.C. 25102521.Thisemailmaybeconfidentialandmaybelegallyprivileged.Ifyouarenottheintendedrecipient,you areherebynotifiedthatanyretention,dissemination,distribution,orcopyingofthiscommunicationisstrictly prohibited.Pleasereplybacktothesenderthatyouhavereceivedthismessageinerror,thendeleteit.Thankyou. CƩƚƒʹGeoffStrack<Geoffrey.Strack@WasteConnections.com> {ĻƓƷʹWednesday,April19,20231:49PM ƚʹAamodt,Daniel(MPCA)<daniel.aamodt@state.mn.us> /ĭʹRyanO'Gara<Ryan.O'Gara@WasteConnections.com>;Shustarich,Thomas<thomas.shustarich@stantec.com> {ǒĬƆĻĭƷʹRE:SKBRosemount2022MajorModificationTechnicalAdequacyLetter Dan, 3 Qbhf!286!pg!311 Checkingbackinonthestatusofyourreviewanddraftpermit.Thereareafewneighborsthatareinterestedinthis expansionandincontrasttowhatyoumightbeusedtoareinterestedinseeingthisgetdonesoonerthanlater.They aretheonespushingusforup dates. Thankyouforsharinganyinformationyoucan. GeoffreyStrack RegionEngineer CƩƚƒʹAamodt,Daniel(MPCA)<daniel.aamodt@state.mn.us> {ĻƓƷʹMonday,March27,20232:08PM ƚʹGeoffStrack<Geoffrey.Strack@WasteConnections.com> /ĭʹRyanO'Gara<Ryan.O'Gara@WasteConnections.com>;Shustarich,Thomas<thomas.shustarich@stantec.com> {ǒĬƆĻĭƷʹRE:SKBRosemount2022MajorModificationTechnicalAdequacyLetter Geoff,Ididreceivedtheresponseandattachments.IwillreachoutifIhaveanyquestions.Thanks,DanAamodtEngineer,SolidWastePermittingUnitResourceManagement&AssistanceDivisionMinnesotaPollutionControlAgency520La fayette Geoff, Ididreceivedtheresponseandattachments.IwillreachoutifIhaveanyquestions. Thanks, DanAamodt Engineer,SolidWastePermittingUnit ResourceManagement&AssistanceDivision MinnesotaPollutionControlAgency 520LafayetteRd St.Paul,MN55155 6517572435 daniel.aamodt@state.mn.us NOTICE:Thisemail(includingattachments)iscoveredbytheElectronicCommunicationsPrivacyAct,18U.S.C. 25102521.Thisemailmaybeconfidentialandmaybelegallyprivileged.Ifyouarenottheintendedrecipient,you areherebynotifiedthatanyretention,dissemination,distribution,orcopyingofthiscommunicationisstrictly prohibited.Pleasereplybacktothesenderthatyouhavereceivedthismessageinerror,thendeleteit.Thankyou. CƩƚƒʹGeoffStrack<Geoffrey.Strack@WasteConnections.com> {ĻƓƷʹMonday,March27,20231:40PM ƚʹAamodt,Daniel(MPCA)<daniel.aamodt@state.mn.us> /ĭʹRyanO'Gara<Ryan.O'Gara@WasteConnections.com>;Shustarich,Thomas<thomas.shustarich@stantec.com> {ǒĬƆĻĭƷʹRE:SKBRosemount2022MajorModificationTechnicalAdequacyLetter ŷźƭƒĻƭƭğŭĻƒğǤĬĻŅƩƚƒğƓĻǣƷĻƩƓğƌĻƒğźƌƭƚǒƩĭĻ͵ Donotselectlinksoropenattachmentsunlessverified.ReportallsuspiciousemailstoMinnesotaITServicesSecurityOperationsCenter. Dan, Justconfirmingyourreceiptoftheresponseandattachments.Welookforwardtoreviewingadraftpermit. Thanks. GeoffreyStrack RegionEngineer CƩƚƒʹGeoffStrack {ĻƓƷʹTuesday,March21,20232:48PM ƚʹAamodt,Daniel(MPCA)<daniel.aamodt@state.mn.us> /ĭʹRyanO'Gara<Ryan.O'Gara@WasteConnections.com>;Shustarich,Thomas<thomas.shustarich@stantec.com> {ǒĬƆĻĭƷʹRE:SKBRosemount2022MajorModificationTechnicalAdequacyLetter Dan, Attachedisacopyofourresponseletteralongwith: Checklists(previouslyemailed) PhasingDrawingshowingCell7PartiallyFilledΑUsedForPermittedCapacity CompostDrawing(previouslyemailed) UpDatedContingencyActionPlan CurrentFinancialAssuranceBonds 4 Qbhf!287!pg!311 Pleaseletusknowifyouhaveanyfurtherquestions. GeoffreyStrack RegionEngineer CƩƚƒʹAamodt,Daniel(MPCA)<daniel.aamodt@state.mn.us> {ĻƓƷʹWednesday,February1,20236:20PM ƚʹGeoffStrack<Geoffrey.Strack@WasteConnections.com> /ĭʹRyanO'Gara<Ryan.O'Gara@WasteConnections.com>;Shustarich,Thomas<thomas.shustarich@stantec.com> {ǒĬƆĻĭƷʹSKBRosemount2022MajorModificationTechnicalAdequacyLetter Geoff,IhavecompletedmyreviewoftheMajorModificationApplicationforSKBRosemount,pleaseseetheattachedcommentletter.Iknowwearestillwaitingontheresultsofthehydrogeologicinvestigationfortheexpansionareaandw ewill Geoff, IhavecompletedmyreviewoftheMajorModificationApplicationforSKBRosemount,pleaseseetheattached commentletter.Iknowwearestillwaitingontheresultsofthehydrogeologicinvestigationfortheexpansionareaand wewillneedthatinordertoprepareadraftpermit.Wealsowilleventuallyneedanupdatedsamplingandanalysisplan butitmaybepossibletomakethatasubmittaliteminthepermititselfsoitcouldpotentiallybesubmittedatalater date.Iwillhavetodiscussitmorewithourhydrogeologists. Pleasereachouttomeifyouhaveanyquestionsorifyouwouldliketogooveranyofmycommentsinmoredetail. Regards, DanAamodt Engineer,SolidWastePermittingUnit ResourceManagement&AssistanceDivision MinnesotaPollutionControlAgency 520LafayetteRd St.Paul,MN55155 6517572435 daniel.aamodt@state.mn.us NOTICE:Thisemail(includingattachments)iscoveredbytheElectronicCommunicationsPrivacyAct,18U.S.C. 25102521.Thisemailmaybeconfidentialandmaybelegallyprivileged.Ifyouarenottheintendedrecipient,you areherebynotifiedthatanyretention,dissemination,distribution,orcopyingofthiscommunicationisstrictly prohibited.Pleasereplybacktothesenderthatyouhavereceivedthismessageinerror,thendeleteit.Thankyou. 5 Qbhf!288!pg!311 Qbhf!289!pg!311 Qbhf!28:!pg!311 Qbhf!291!pg!311 Qbhf!292!pg!311 Qbhf!293!pg!311 Qbhf!294!pg!311 Qbhf!295!pg!311 Qbhf!296!pg!311 Qbhf!297!pg!311 Qbhf!298!pg!311 Qbhf!299!pg!311 Qbhf!29:!pg!311 Qbhf!2:1!pg!311 EXECUTIVE SUMMARY City Council Regular Meeting: October 17, 2023 AGENDA ITEM: PD PW Campus Update and Change Order Package AGENDA SECTION: #1 NEW BUSINESS PREPARED BY: Logan Martin, City Administrator AGENDA NO. 9.a. Mikael Dahlstrom, Police Chief Nick Egger, Public Works Director ATTACHMENTS: Rosemount PDPW October 23 Update, Rosemount APPROVED BY: LJM Overall Budget 10.12.23, Change Order Summary Log, Change Order detail 10-1-23 RECOMMENDED ACTION: Motion to authorize Change Order Package #1 for the Police and Public Works Campus project through October 2023. BACKGROUND The construction of the new Police and Public Works Campus has been progressing rapidly since July, and the project remains on track and within budget. Staff meets weekly with the construction team on-site to receive detailed project updates and to provide input on a myriad of items that arise during construction. In order to keep the City Council and community updated on the project, staff will provide a monthly report to the City Council. This will also provide staff an opportunity to update the City Council on any change orders that occurred on the project, and Council authorization of change orders will be requested during this action. As a reminder, the City Administrator is authorized to execute change orders up to $50,000. Due to the rapid nature of this project, staff is requesting City Council support to authorize change orders above $50,000 if time is of the essence and if the project contingency budget is adequately funded. Staff will still bring a monthly report of all change orders to the Council, and will request formal authorization at that time. Change orders authorized or pending from construction start to present are attached. All changes are below the $50,000 threshold but for the following: Structural Steel Clarifications - $248,779.18 o Required structural steel additions to update the structure from Bid Package #1 to Bid Package #2. This change was always anticipated as the full structural design wasn't known prior to Bid Package #1. Verkada Camera / Door System Change - $100,000 o Owner requested change to provide significant functionality / security improvements to the previously selected camera / door access system. This system will better align with the overall system utilized at City facilities. Qbhf!2:2!pg!311 Tekton High Density Storage = $95,020.79 o Provides critical storage system in the Police Evidence Area. This item was previously removed from the design to reduce the project's budget, however it is strongly desired and positive bids in other areas allow for this re-addition to the project. Kraus Anderson has indicated that the initial phases of construction (steel, soil corrections, concrete / masonry) typically contain the largest cost change orders. The contingency budget for the project is still well funded, with 3.9% (1,772,019) in construction contingency remaining. Attached for review is a project update infographic, the current project budget report, and the detailed change order listing. RECOMMENDATION Staff recommends the City Council authorize Change Order Package #1 and direct staff to provide monthly updates to the Council on the PD PW Campus project budget and change order status. Qbhf!2:3!pg!311 ROSEMOUNT POLICE & PUBLIC WORKS CAMPUS PROJECT UPDATE October, 2023 SCHEDULE Budget SUMMARY: SUMMARY: The project is currently tracking within the $58.2Million total The project is currently tracking on schedule for a end of project budget. See attached detail overall budget sheet. 2024 completion. CONSTRUCTION: RECENT ACCOMPLISHMENTS: - Change Orders Executed: $383,769 - Site grading and utilities are completed for this year. - Pending Change Orders: $264,498 - All foundation for the main building are completed. - Remaining Construction Contingency: $1,772,019 (approx - Masonry wall installation continues. 3.9%) - Precast wall panel and plank installation continues. - Structural Steel and roof joist and decking has started in Contracts yet to procure but included in the budget: PD. - Landscaping (Bidding 10/18) - Commissioning UPCOMING THE NEXT COUPLE MONTHS: - Furniture, Fixtures & Equipment - Precast installation completion in the next month. - Structural Steel, Roof Joist and Decking continues in PD and starts in PW in November. - Exterior Wall framing begin end October. - Roofing on the PD begins October/November. POTENTIALCHALLENGES: - Early cold weather / winter Scan for Photos and Site Updates Qbhf!2:4!pg!311 Qbhf!2:5!pg!311 Fyfdvufe!Dibohf!Psefst!Upubm;!!%494-879/92 Qfoejoh!Dibohf!Psefst!Upubm;!!%375-5:8/88 Qbhf!2:6!pg!311 Detailed Narrative of Approved COs through 10/1/2023 PCO #1: ASI 1 Structural Changes from BP 1 to BP2: See COR 4 for all contractor pricing and back up. -Civil plan changes to bike rack locations and storm sewer structures. -Changes to washout and material bin foundations. -Revisions to monument sign sections. -Added and beef-up roof joists for final roof top equipment weights. -Added steel at perimeter of clear stories. -Revisions to beam and column sizes for final building loads including overhead crane loads. PCO 4: RFI 31 Additional brush clearing and tree trimming on the westside of the site perimeter and adjust SWPPP protection accordingly. PCO 5: Soil correction of the PW vehicle garage to remove the remaining layer of silts. All other areas already had that layer removed per the Geotech report. PCO 6: PR#4: Move the PW precast screen wall east 6’ to allow for a larger turn radius out of the PW garage adding pavement and additional curb and revised details to the east concrete retaining wall. See COR 3. Qbhf!2:7!pg!311 PCO 7: ASI 3 Civil Clarifications changes to utilities including adding a gate valve to the watermain and revisions to the storm sewer routing. PCO 8: ASI 5: Changed the strength of the under concrete slab insulation from 25psi to 40psi where infloor heat is located at heavy truck load areas. PCO 11: ASI 4 Structural Items Added step footing in foundation walls and revised foundations of the PW screenwall 3’ deeper to provide proper freeze protection of the foundations cover due to the shift closer to the stormwater pond. Qbhf!2:8!pg!311 Qbhf!2:9!pg!311 Qbhf!2::!pg!311 Qbhf!311!pg!311